SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM179220-PA|EEB12441.1|transcription from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM179220-PA|EEB12441.1|transcription
Domain Number - Region: 5-111
Classification Level Classification E-value
Superfamily Histone-fold 0.00237
Family TBP-associated factors, TAFs 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM179220-PA|EEB12441.1|transcription
Sequence length 120
Comment initiation factor TFIID subunit, putative|DS235138.1:45306:45842:-1|gene:PHUM179220
Sequence
MNGENVNDSSEPHTAGQPLSDFLQQLEDYTPTVPDAVTAHYLHSAGFDSSDPRIIRLISL
AAQKFISDVANDALQHCKTRSSHQASKTKGKDRRYTLTMEDLAPALAEYGICVKKPQYFV
Download sequence
Identical sequences E0VGD5
XP_002425179.1.24195 vb|PHUM179220-PA|EEB12441.1|transcription 121224.XP_002425179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]