SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM189890-PA|EEB12543.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM189890-PA|EEB12543.1|cAMP-dependent
Domain Number 1 Region: 212-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-86
Family Protein kinases, catalytic subunit 0.00000035
Further Details:      
 
Domain Number 2 Region: 74-205
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.00068
Further Details:      
 
Domain Number 3 Region: 5-63
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000017
Family cAMP-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM189890-PA|EEB12543.1|cAMP-dependent
Sequence length 542
Comment protein kinase catalytic subunit, putative|DS235150.1:323739:326278:-1|gene:PHUM189890
Sequence
MLPTQGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATTKAATDCKLWAIERQCFQTI
MMRTGLIRQAEYTNFLKSVPIFKNLPEDTLIKISDVLEEAYYNQGDYIIRQGARGDTFFI
ISKGEVKVTIKQPNTSEEKYIRTLGKGDFFGEKALQGDDLRTANIIANDPEGVTCLVIDR
ESFNQLISGLDEIRTKYADEGIERRNVNETRWVRLINVVNEEFRDLKLSDLRILATLGVG
GFGRVELVQIAGDCTRSFALKQMKKSQIVETRQQQHIMSEKDIMSEANCDFIVKLYKTFK
DRKYLYMLMESCLGGELWTILRDKGHFDDSTTRFYTACVVSAFDYLHSRNIIYRDLKPEN
LLLDVQGYVKLVDFGFAKKLQHGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMF
ELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATVLIKKLCRDNPVERLGYQKGG
ISEIQKHKWFDGFNWEGLTTRTLTPPILPKVQDALDHSNFDEYPPDADGPPPDDITGWDQ
NF
Download sequence
Identical sequences E0VGN7
121224.XP_002425281 vb|PHUM189890-PA|EEB12543.1|cAMP-dependent XP_002425281.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]