SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM189910-PA|EEB12545.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM189910-PA|EEB12545.1|cAMP-dependent
Domain Number 1 Region: 105-163
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000117
Family cAMP-binding domain 0.0049
Further Details:      
 
Weak hits

Sequence:  vb|PHUM189910-PA|EEB12545.1|cAMP-dependent
Domain Number - Region: 13-75
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0235
Family PspA lactotransferrin-binding region 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM189910-PA|EEB12545.1|cAMP-dependent
Sequence length 181
Comment protein kinase regulatory chain, putative|DS235150.1:351620:355528:-1|gene:PHUM189910
Sequence
MATVQELKILLNQKLDDINKKDEMIKFLEQEMDEKDALIRHLKNEIDKFKQVVRPLTKEI
VNRRKCCHDVDDDERHKFGDRPKRQAISAEPLLNGAGEFPIVKIPKSSKSRELIKAAILD
NDFMKNLEPTQIKETVDCMYPVEYAAGSLIIKEGDVGSIVYVMEERRPPSEEEKARTANP
H
Download sequence
Identical sequences E0VGN9
XP_002425283.1.24195 vb|PHUM189910-PA|EEB12545.1|cAMP-dependent 121224.XP_002425283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]