SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM195360-PA|EEB12649.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM195360-PA|EEB12649.1|conserved
Domain Number 1 Region: 1339-1550
Classification Level Classification E-value
Superfamily VPS9 domain 4.84e-43
Family VPS9 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 97-409
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-32
Family p120GAP domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM195360-PA|EEB12649.1|conserved
Sequence length 1550
Comment hypothetical protein|DS235154.1:105388:111750:-1|gene:PHUM195360
Sequence
MLSNWELSDLASHLRRERLFTSSEQQSLKILNEKLKDVSKNLAQLAWISSHQRINLNHLI
LAKVDCLPALLSQRNFTAENVVFVDAYKIIGYQDALAYGEFLSILQSNVELVANCLSVGD
KIFPDSMPEIVYSLSGVLKLLQKLTALQLVPSENPRRMLRHGSCAFARFYSLFHENLYSA
KLFLTAALHYPIIKLLMEDEMFLDIDPDKAVIRFPNEERIKKFGLEGTPDYTAKLQKHRE
WIIKKLVNLTDNFIFSLQENMHCFPTSVCWLVRQMAGLFRKSGYLGEKEIYEICIDLVFT
YFICPAVVNPEPYGITDVPIGYIARFNLMQVAQILQMLAMRKYQEIDGKVADLYDKFHSD
SVSSFLDRILGNYSETLDEPPPNEDNTEIEGILRSAALFTHCELNNLVKFFQNILKSEND
TFDKRQLENLISRLPPTWTNGYKSSTPKHQSEKSMNSASSSQESSLLRKSSVLLSKVNRQ
RNHTSALGANLLGNLDNVDDSKAEEEQPLQILVIPLSGRDGEPVGLLPEQKVLEVEVKRQ
ADAISIGVKGDQTLGKSDVESRGEGQEKRTRFSLSHDEGSIGNTSDNLEAVSEAASNHSG
ASSLESENEDQNDNLSDMVSANVSGRGTPNISGRDTPSSQITEGDEGRGGEEEIRGNVTE
HRQVVPSVSKQTRSDIDDKFGKFEIKKQEVLGDETKSLVSDTWSTDVLASDSETVEQSER
NFPRPPEVDVPSHPFIQHSLDVSETASEAWSTDVLTSDSERLTEVDTDDTASVARSDDTA
SVARSDDTAHSEFGMRGEVDGGETPPPHNSAFRPIKDSSNRISLNVPPSPTRADMWNVTG
RGGVKSDYRRRTIEFVDSGIARNFSTNNVDSNRMIHVIDKMDTKSAVQTNGPMRNGRSGS
APRSRSPQPSQLQSLSNGIENLLPEANLVPNDRSQKVSVDNSTVAVVEQEIGLRVLPDGN
NDVSEEASALFDDSDITPPSPLLSNAFASSSHLPSNSAYLNNSKPQVSYALPYKFNEMKL
KQEGDESEKVFLSSTSLASTSSSGSNSGTAAQPQPVVVRNIEKVNASVTGAIPKSISFDK
TAERGDKEFLDEDQKQRKGFFRNLKMSFKSRKIKHFKGEDLGRFEENISVGNFKIFNGAK
NSNEQETLEEKGVQNGGDAIEDILAKYRNKPATEAEVLVPTDLIEKKLIEADEDEGLSDE
SLFINAKRKLRLVLCNSDLHIYNSGSVVSEDQLVSFLKLQLAEAVNLQNRSLVSQLQETL
RCVRLFDYEGCRRLFKSLKEDYQNRAPYIAYLVRSRQTLLSSIAHFERMIERVESDSRVC
QKFLVALCVRIFLERREDICRSFSKEFQQLSLPDEKTDLLDKFLMELSHQLEKDHNWIGA
NDAQLEQARSIIETAIISRVYPYALYPNGDVDRYRDHVLHEHMKNLASIITPNHKALQIP
KIFHVECPWPSAQAEISALAAYKTPKDKVSCICRCATTIMNLLSMAVDGNVPAADDFVPV
LVFVLIAANPPALLSTVQYVDSFYGSRLEGEEQYWWTQFSSAIEFIKTIN
Download sequence
Identical sequences E0VGZ3
vb|PHUM195360-PA|EEB12649.1|conserved 121224.XP_002425387 XP_002425387.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]