SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM196820-PA|EEB12667.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM196820-PA|EEB12667.1|conserved
Domain Number 1 Region: 183-378
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.48e-31
Family BAR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM196820-PA|EEB12667.1|conserved
Sequence length 828
Comment hypothetical protein|DS235156.1:46239:49736:-1|gene:PHUM196820
Sequence
MTKKSPSYQLGAALLESSGACDEESLMKVVLTKCGHAEKCISEESAEHDSRVEQHVISPL
QNVIEVDFPNIVKQKRNVTKVCLDMDSAKTRYLQAQKHNSHTSGAAKVELIKDELKDSEQ
KVEQSRDVLACEMFHLAARESELCYTVLQYYKFQKRYHEYALGILDKLIPELESDICSSK
TKPVYGVDLEEHLQVTGRKIAFPIELCVCALLELGMEEEGLFRLAGGASKLKRMKLSFDA
GCMTLATALTYRDPHVIAGALKSYLRELPEPLLTHSLYDEWLNAAKAQTHPDNKLQALWT
VVHKLPKPNFDNLSYLIKFFHILSKNHEINKMSPHNIAIVIAPSLIWTKDENGFGLNVNV
SLYPSIIDLLVTYADWFFDKEMDFYLTLEPIMNGEVEEKSSEKGIDNKGFDLKLADKMNK
SAIEKNSGQNHPGGDYDSNTSEMSRSQSTTCLSEETQAYESPKPITRRKNKSIAPGPPIC
KDEKRKDGQLGKDNVKTKEIHVFNDKPDKPPRPTVVSNSTLPRPSKSNRENKINENNEEI
MKKQPVDDIVLSKKLDESNEKAFKMNRTSMDPNNFRNNYENILLSSNENLNTGSTDDNRT
LQKNYSVINKQQQISVIEVGSSNKNNSNNKVSDNNTSGVVDDDADLIPSGRTTSMEKTVN
DNKTFESEVDKDADADDDDDKDVVVVQERKTAAVTSNRPLSLPGSEKPERPPKPDYKFSS
PPSSHTRTFSDGQIIDMKPSDNTSNNNNNNNGNVNISTNMSSGNSHCIKQFTSSTNTTSE
TPSPTPPLSMSSSPPVSSIFIKHPQTSPPPPPVPAKPRANSQSESTDF
Download sequence
Identical sequences E0VH11
vb|PHUM196820-PA|EEB12667.1|conserved XP_002425405.1.24195 121224.XP_002425405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]