SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM202560-PA|EEB12733.1|tyrosine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM202560-PA|EEB12733.1|tyrosine-protein
Domain Number 1 Region: 841-1101
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-71
Family Protein kinases, catalytic subunit 0.00000598
Further Details:      
 
Domain Number 2 Region: 496-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-33
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 309-410
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000539
Family SH2 domain 0.0019
Further Details:      
 
Domain Number 4 Region: 92-164
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000293
Family Second domain of FERM 0.006
Further Details:      
 
Weak hits

Sequence:  vb|PHUM202560-PA|EEB12733.1|tyrosine-protein
Domain Number - Region: 222-303
Classification Level Classification E-value
Superfamily PH domain-like 0.0123
Family Third domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM202560-PA|EEB12733.1|tyrosine-protein
Sequence length 1108
Comment kinase jak2, putative|DS235161.1:248329:252944:1|gene:PHUM202560
Sequence
MGSPERLAEIRLLTERNNIKVPVYDTTTVEDVCLEIAKTLGIGPICRHLFSLRVRDTKIW
LFPSYKLSEMRSDCVFDYRLRFKVPKLSRLKQIDLEAFNYYYHQVRKDILDNQVPDISYE
KHKGELLGLGVTDMYRVMIEQGLSVDQIESDYKKYIPKSLLKHHFLFIKPKIHTSLSKIK
IKKEQDGWFVKEEYLNLFDKIAPNYLSEKYNAQMDDGGSIKLVSIHVNPFAKEQSGINYL
FDEKDEWQYLCSIEELCYISVRNDGTVEICRKNGIPSYFRFTSTLVMYSFVSLLDGYYRF
SCKWIFNLCKDVFSPSLKTLQNLKCHGPVGGQFSYSKLEEKRNNKPGTFIIRESETLYDI
YYLDVCTQNSAKPKTFKIEKVKGAGYFFSFDQKTYPTMVALVNAYRHSDGEVTLLECIPP
SEFDKTQLLVCASDLKVDKSGNLPVDSLDTIKSSSPIIINIKNLQVFKGVKKESQSSLMY
HYRSILKLQNGGKVEASMKVLKPEFRDSYLSELLELAGSWACLQSNSIVKLFGITLRGPV
SMVSEYLPYGPFDAYLRDKKILMKDVDLVEAGTYIASALWHLEECGIVHGNIRCRKLLVS
VHNENTCLIKLCDPGLHKYSNEDVHWIPPECYYDFKLAKTIPSADVWAFGTTLWEIFSFG
ATPDMGNDKDNYIRGKRLGLPIGCPIDIYRLILECWDADIDRRKKPQAIMRDINQILYQV
FNSRRVHSYATAFPKAFKNDDQDSMTESNTSLWSDATAETFLVTDIPTDNLIPLSDLSSS
CTIDNPKIENLLFKGLGEAYSTQIMSPNISAFLAQFQSSLSSSLDSDTYIQSIFEIDKNC
NVVLQGRIGQGFYGEVYKGILERADHEPQLVAVKKLKANALSTTRHDLEREISIMESLKH
KNIVEIIGAIHEPDISLVMEYVQYGSLQTYLKINKETLKPESLLKFASDVASGMVYLGKK
NIVHRDLAARNILVASENHVKISDFGLAQVVEQNSYYILKTNRELPIKWYAPESLRDGRF
SHYSDVWSYGVTLYEMFSLGEDPTLPCCSDDVNQSQLLTALEGGARLPCPPTCPQLVYVK
VISPCWKLDSKERPTFTMIFDKIQKIRL
Download sequence
Identical sequences E0VH77
vb|PHUM202560-PA|EEB12733.1|tyrosine-protein XP_002425471.1.24195 121224.XP_002425471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]