SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM209200-PA|EEB12822.1|suppressor from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM209200-PA|EEB12822.1|suppressor
Domain Number 1 Region: 379-473
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-22
Family SH2 domain 0.00018
Further Details:      
 
Weak hits

Sequence:  vb|PHUM209200-PA|EEB12822.1|suppressor
Domain Number - Region: 592-611
Classification Level Classification E-value
Superfamily SOCS box-like 0.0124
Family SOCS box-like 0.0073
Further Details:      
 
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily SOCS box-like 0.0144
Family SOCS box-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM209200-PA|EEB12822.1|suppressor
Sequence length 613
Comment of cytokine signaling-2, putative|DS235170.1:44913:47065:-1|gene:PHUM209200
Sequence
MLSAMTTSENFPLINQSRCSPSPQYNPVIQPGYVATILRQNLQVMSNDGNILKYQLIQEP
EINKAGEMKFGKIYSATDMEKIKSITSFVGWKTCRKNSCKLSGGGLMERDDGFLIDDSHC
HVLANQISPSTPLTFDLTSPQNVINCCVSERRRRRGMSDIVVGNTKSSEIESTNPFKNFI
VNNNNNNNDFVENEKPFSPTNPFSDLCASSSPNRFSQIEYNPPIRYENIIIPHKSFSQCS
TRPASPVLRNVNNNNNNKEESTISNPFLINDTSQDSILFDTRTSKLFIKDSLQSDQSGSS
LKNHSSFIFAVPVLSLISPQSSITNSTSTQTTGDIEEMEKIPKRSKESPPPVYQNLTNQL
EKFIKMNDHSDYDLMCLKTTVKDLRTSGWYYENVSWQESVILLKDTDPGTFLIRDSSDPN
FLFSLSVQTSRGPTSVRLHYVNGHFRLDAEEKLIPHMPSFGSVIELIDYYVENTVKNKTT
SKKNGQKTKQQQQQQQQQWMQKSKDQVWIDSQGNVYSNILLVKPLYKKDHFSSLQHLARL
TINFRLKKRLNVKIKNNNNFKVTPVYESSPFQDSTSFFQYQNNFESFCPILSANALPIPP
KLIEYLQDYPYCH
Download sequence
Identical sequences E0VHG6
vb|PHUM209200-PA|EEB12822.1|suppressor XP_002425560.1.24195 121224.XP_002425560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]