SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM210970-PA|EEB12860.1|Cyclic from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM210970-PA|EEB12860.1|Cyclic
Domain Number 1 Region: 326-512
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-44
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 74-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000235
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM210970-PA|EEB12860.1|Cyclic
Sequence length 557
Comment nucleotide-gated cation channel alpha, putative|DS235171.1:90091:91952:-1|gene:PHUM210970
Sequence
MSSPEKYFNKQMKAHKCQLPPNDDLEFLMSLNKFKNFFLVSEKNLLSYLKFKSQSAICYE
KRRQIRTTRCFIIHPYSELNRAWKLWMCIVLLMAVIIFPFTSSFLGPYYVKSAVTVESTL
LRFQMLLSTVFIIRIFCLMDIVVTFFTGYINSSTDEMVIQPSRIARHYISTYFFPDLISS
VPIDFIYICVYGMKSXXGSFFSSYSIYKTVAAIVFYFLLIHWGACLHFLIPRLIYYHELL
NCQKGRCRYSWLTVSRLTKKTLFKQYATGAYKTLTCFARLGNENITLINVEDKVLSILLG
FVGIIYWMLLLIVSIKMYSTITLGKASYLEIIDQVRHYMNLKKFPPNLRRRIEMYYTYMF
QKDFVPEQRILQFLSENLRQETILKMHQNLVEKVYMFSSLNETLIYEIIRCLKREIYLTG
DYFYKFGEIGTCMYFISFGTVAIYTEKGKEIGHLEDGEYFGELSVLFNVRRPVTVVAIET
TEAFSFQNDDFMKIIKPNVKIYARMEKIGLERIKKSRNVASNTHTSWKLKSNESKHSKVY
AVIKRKRQIYTVIITAA
Download sequence
Identical sequences E0VHT7
XP_002425598.1.24195 121224.XP_002425598 vb|PHUM210970-PA|EEB12860.1|Cyclic

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]