SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM213020-PA|EEB12905.1|mtm1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM213020-PA|EEB12905.1|mtm1
Domain Number 1 Region: 561-949
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-157
Family Myotubularin-like phosphatases 0.0000000000565
Further Details:      
 
Domain Number 2 Region: 435-557
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-42
Family GRAM domain 0.00000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM213020-PA|EEB12905.1|mtm1
Sequence length 1000
Comment mtmr1,2, putative|DS235171.1:417838:423464:1|gene:PHUM213020
Sequence
MAKVYKSICNEIDLTLLNIAHIIEKIIRYKVEIETLMNKGFVSIAKARYIMGSTCVTKMQ
LPSEKSNPIQPLATVCRAQRNNHWVFHIHRKDVPKPSSSNDEKIDNLETDEVSKESFVTN
YHSESQFKNVLQNDPKSLKKSKFAYHVDDNKYQECNNEFLDEFSNHSGSNESLHSLDEPL
RLFGVLVPNTLKHGQETFKEVVGCLGKCATLQSQLIESLSKYGHLMQVKGLMEMAAVKGN
INISQPKVYWTIDDVTSTSGYSDEIGEEREVNEEAEEEEEEEEEEEEEENEKEEVKKEEQ
KEMKKEEVKEVKKEEVKEKEADTVNVTKSVRSVFYNLNELENEKSEWENVMDSKPNNGNG
STGDTNNSKDASSDSLVSDSKSSSLNSKLGQEHGGNSWGKSPSGSSSTSAENIGSAFENL
LNYKPKAIHHVRGDDPPLLPGESVKGTAKEVAYICPYLGPIRGVLCVTNYKLYFKSSDRD
APYILDVPLGVVSRIEKVGGATSRGENSYGIDVFCKDMRNIRFAHKQENHSRRDVFEKLQ
QFAFPLSHKKPIFAFSYTETFNENGWNIYEPIGELKRMGVQYPNDMWRITKINENYEICD
SYPSIIAVPAQATDEELRAVSAFRSRGRLPVLSWIHPESQVTITRCSQPLVGVSNKRCKE
DEHYIQLITDANAQSPKLYIMDARPSSNAIANIAKGGGYESEDAYKNAELIFLDISNIHV
MRESLRKLKELCFPMIDVSRWLSGIESTCWLKHIKTILSGAIRIVDKVESHNSSVLVHCS
DGWDRTSQLTALAMLMLDPFYRTIKGFEILIEKEWLSFGHKFEQRIGHGDEHHSDSDRSP
VFLQFIDSVWQITQQFPCAFEFNEHFLICILDHLYSCRFGTFLCNSERERASLNVKQKTV
SLWSYINSNIDIHKNPLYWASSQNQIILIPNASMRHLKLWKSYYCRWNPSMRTQDPIHRR
TRELILLKEQLEKQIQDCRQEQQMRASKNMSTPSRLSTLH
Download sequence
Identical sequences E0VHL9
121224.XP_002425643 XP_002425643.1.24195 vb|PHUM213020-PA|EEB12905.1|mtm1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]