SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM220580-PA|EEB13047.1|Diacylglycerol from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM220580-PA|EEB13047.1|Diacylglycerol
Domain Number 1 Region: 262-395
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.66e-25
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 1236-1417
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.37e-22
Family NAD kinase-like 0.051
Further Details:      
 
Domain Number 3 Region: 1629-1694
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4e-18
Family SAM (sterile alpha motif) domain 0.004
Further Details:      
 
Domain Number 4 Region: 175-233
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 
Domain Number 5 Region: 98-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000102
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 6 Region: 38-88
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000126
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM220580-PA|EEB13047.1|Diacylglycerol
Sequence length 1695
Comment kinase delta, putative|DS235184.1:144265:152487:-1|gene:PHUM220580
Sequence
MNILRERMESFVIGCNVENFCGTCGRFVGINNALIFDEIEISNISFGQVGTKNTNNSFQI
ITPFRRLVLAADTKAEMEEWIAALKVANSKEYYEGGEHEDFLSGHHHWYATFHARPTYCN
MCREPLSGVTSHGLSCEICKCKVHKRCAVKTLPNCKWTTLASIGQDIIEDEFGNVIMPHQ
WIEGNLPVSSKCSVCDKTCGSVLRLQDWRCLWCRAFVHTACRPQHPVKCPLGLAKVSVVP
PTTLNSIGNDEAWEAVRPQGCSPLLVFVNSKSGENQGIKFLRRFKQLLNPAQVFDLIHGG
PGLGLRLFRHFDPFRILVCSGDGSVGWVLSEIDRLNMHKQCQIGVLPLGTGNDLARVLGW
GASCDDDTHLPQLLDKYEKASTKMLDRWSVMTLERGMILPTTVSKLSLDETLLALTVSEY
ENNVMSHLAKIIQSDQHSVVISSAKILCETIRDFTLRLAHSSLAHGDDLLSEKCQQLNNK
LDMLVQILEEEGGGGGGGGGGGGVAPKILSKKPSDSISSEDGEKLAKEKQEKDFINLREK
SNKINVEKDALVSRANSLKKAVSQLVEYVESAVDMQNVQETSGATTTQALFRIQTLGKNE
LEVPNKFPKIKSVPFESSLGTLPKCDDTQKFFLLPSPVHSCSSSRSPSNADIRISSLSPL
PDVRRESASDEMITLPVPNEFADNLARRRSFPLGKETEGGVVPSQNLAVPLDIDIKLFKG
DVSVERNLLKFEKDVLCEFENSQSSSLWENVVSSLNEDARNLVIENKGMTSSQDIVAERG
RRLLLPDDDDDDEKEKIIKIVTTEMNLNVEIEESTTDGRSNENGKKEKEPEGTDKRDSEP
YLFLTGGTCDDDLEKTFNKRIDEMDLSHIDSSESPSEETSPPNQGSSPPLGRIAPGPPRI
VHKSFTENFLRVKEEGKVSKSLTEINGDYLKLVKCYDDGRLFSDEGKIRRHSDIKTSKDI
TNAMNLAKKSPYIDEEHLLCRKDSRRLYLENDIDITDDIELEPELRCSLAHFVEGNDIAR
MSFKKKPRRIVKKLEEDLTSDLVKIQFKGSNGDLTKEWNEKFNEGNKMDVISGPGYSETD
DEDVDLTRVDVDKSKVKIDSVPEFQFVIDPPSPVHEDETRRSSGESKGKLSALTSVSTGL
LQASPQATRRVSNCSLMKAEIMEFVESRNRSKSFDKSDVDVVKKLPIINPLVRLPMWPNV
SGGAGLISQVLLANADALCATAAPLMDFDETLLQGFYEKCVMNNYFGIGIDAKIALDFHH
KREEHPEKCRSRAKNYMWYGVLGSREWLQKTYKNLEQRVQLECDGQRIPLPSLQGIVVLN
IPSFMGGTNFWGGKEEDDCFLAPSFDDKILEVVAVFGSVQMAASRLINLQHHRIAQCQTV
QINVLGDEGVPIQVDGEAWIQPPGVIRIIHKNRMQMLCRNRALENCLKSWEEKQRQSQQV
QTQQLTQASQTVATSSSHSSTGVETNFPTLLTEEESRLLFGFIEVTTTLVKCVQLVTISH
NTLDTELYNLATKTTKSLENVHPGGKILEGPELRLKVTELVNSGKDLYEEVCSMLRDKGS
NLKLREDMEGKLNSALADMEIELRKCSVDENGLVGLHHIFEQSGTNKGRGRGLFWLKLRR
HGGNQRQREASSWGVAEVSQWLESLQLSEYVDSFAKNDIRGKELIALARRDLKDLGVTKV
GHVKRILQAIRDLNT
Download sequence
Identical sequences E0VI41
XP_002425785.1.24195 vb|PHUM220580-PA|EEB13047.1|Diacylglycerol 121224.XP_002425785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]