SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM221150-PA|EEB13064.1|Type from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM221150-PA|EEB13064.1|Type
Domain Number 1 Region: 211-553
Classification Level Classification E-value
Superfamily DNase I-like 6.91e-70
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000125
Further Details:      
 
Domain Number 2 Region: 672-681,709-884
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM221150-PA|EEB13064.1|Type
Sequence length 893
Comment II inositol-1,4,5-trisphosphate 5-phosphatase precursor, putative|DS235184.1:440377:444784:1|gene:PHUM221150
Sequence
MDVILARHREINVTNNTIPDQHVNKLYEKISTDLLRTHNGNLSDDTNSYCVLSLVEKNIQ
GSAEHALFIFKSSTSSPVSFLDLTCKYIIPVDENFICDFSTPLKTANDGVNLFIHITGRH
NTNIKCKTSECEQTSNFISEIFRLIEVSAKNKNNCDFSWITPFLTSYPPEMETGRSREVD
LEQSFLDSSDMAIQRQNIAKGGQSSISAREQIIKHYMTLKANEYTYTQNVKIFIGTWNVN
GQPAAVSLSDWLTTTNPEYPDVPDIYAVGFQELDLSKEAFLFNETPREGEWLEAVSNALQ
NHKSVTYHKICLVRLVGMMLIVFVQDKHIDHVRNVVSDTVGTGIMGKMGNKGGIGVRFDF
YATSMCFVNSHLAAHVEEYERRNQDFKDITSRMGFTVQNSRYAIKDHKQVYWLGDLNYRV
TELDPTVVKEFLRFNNFRPILEYDQLNLQKKLKRVFDGYTEGTINFRPTYKYDTGTDNWD
SSEKNRAPAWCDRILWKGEGVQQLVYKSHPALKISDHKPVSSLFDSKVHIIDEGKQRKTH
EEVIKCLDKMENEFLPQVTVDSNEIIYDTVRYLEPVTKELIIANNGQVPAQFAFIKKLNE
TSFCKEWLRIEPYQSLIAPGQKCDVRLEILVDKKSACKLNSGEDKLYDILILHLEGGKDI
FITVTGTYERSCFGSSIETLVRIFVPIKELTVGKLIELENNKGHTAGGGQEPYAIPKEIW
FLIDHLYRHGLKQSLFVQPGLQSEIIQIRNWLDYGSSDPIPGSVHSVAEALLLLLESTSE
PLIPYNLHNICISCSNNYTECRQLIMQLPEYRKNVFLYLCTFLHELLSHSNVNELDTRLL
ATVFGRIFLRDPPGRRYPETVKDRSVQQELDKKKSNFVHHFLINDQSDFIFTR
Download sequence
Identical sequences E0VI58
vb|PHUM221150-PA|EEB13064.1|Type XP_002425802.1.24195 121224.XP_002425802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]