SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM221270-PA|EEB13073.1|arf6 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM221270-PA|EEB13073.1|arf6
Domain Number 1 Region: 569-728
Classification Level Classification E-value
Superfamily Sec7 domain 7.2e-54
Family Sec7 domain 0.0000551
Further Details:      
 
Domain Number 2 Region: 744-777
Classification Level Classification E-value
Superfamily PH domain-like 0.00000389
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM221270-PA|EEB13073.1|arf6
Sequence length 904
Comment guanine nucleotide exchange factor, putative|DS235184.1:523384:528741:-1|gene:PHUM221270
Sequence
MKKVLFIKVERGFKPSILDEPTVSEPKKKSITNSEKFLKDSFGKDENHYGNNNKTKTPRF
EAFMMTGDLILNLSRTQQSSGILPKRQKKIDSLRYHHHKNHNRQDHHNSVPTSPNESNSG
IRKRSLSSPPESPTSTDESKTFGGTSCYTFQTGVRTSRSEDHLQCQKNSSISTVDIDIDD
DIRSSLNTLLDTRVDGDKTTTHHCNSISDRIGTGPIDDRSSDSLEMSSSNTTVLHIAEEP
PHVKLEISNGSQNTSGERKTKPSEEGKRISEPPHKREENRKSGNFDKINNECSKNSGLEK
GSPKTDRIVWTYNAPHSGSPSHSNCGSVSGSEHNLCHASTISSSSSSQRSLSPVSPTSVS
SSIMSSNSNSLQQKNQQPEIEMKPQSNHNSIPDHWNPTSDVSASEAVSNISSPDYQEEIT
MDILNARDLMMEISDPSDSDSTLLVSDPVSGSQNRSTANSDKNEEKMPRGKSKLNGKPNC
FFSNTSDHKIIIQVKGPETTNVIRNNNNFYQEKETTEQTNSEESKEKEGCDETCEDGVNK
SPSQSGSDEDSDIESLHSFHYSPKAVDLPSAIRLAKRLYTLDGFKKSDVSRHLSKNNDFS
RAVAEEYLKHFTFTKDTLDTALRKFLKQFSLAGETQERERVLVHFSKRYLECNPGTFNSQ
DAVHTLTCALMLLNTDLNGQNISRKMTCEEFIDNLRDLNEGENFPRDILKALYQAIKNYP
LEWALDDEADRVSNQLSVDEKGDLKTAEQAVYLFQTGDAKELQSWIDTINFVCASYSAQP
LASGVGSENKFQRPLLPCSHTKLKLREQLADHEDRVQKLEMALEEHRRDPPDRSAKSLFI
QNYKEKDAYLQYEIKRYKTYVNILRLKMPQYSDSIIGNSFGDDHVDGGIVPPPVPDRRIT
PSNR
Download sequence
Identical sequences E0VI67
vb|PHUM221270-PA|EEB13073.1|arf6 121224.XP_002425811 XP_002425811.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]