SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM221320-PA|EEB13078.1|WD from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM221320-PA|EEB13078.1|WD
Domain Number 1 Region: 2559-2848
Classification Level Classification E-value
Superfamily BEACH domain 1.09e-124
Family BEACH domain 0.0000000234
Further Details:      
 
Domain Number 2 Region: 2919-3128,3423-3457
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.87e-33
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 2404-2527
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-22
Family PreBEACH PH-like domain 0.0098
Further Details:      
 
Domain Number 4 Region: 3465-3535
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.73e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 1054-1208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000099
Family Laminin G-like module 0.098
Further Details:      
 
Domain Number 6 Region: 402-650,850-916
Classification Level Classification E-value
Superfamily ARM repeat 0.00000259
Family Armadillo repeat 0.09
Further Details:      
 
Weak hits

Sequence:  vb|PHUM221320-PA|EEB13078.1|WD
Domain Number - Region: 1353-1630
Classification Level Classification E-value
Superfamily ARM repeat 0.00173
Family Regulatory subunit H of the V-type ATPase 0.073
Further Details:      
 
Domain Number - Region: 132-164,191-268,303-367,394-461
Classification Level Classification E-value
Superfamily ARM repeat 0.00541
Family Plakophilin 1 helical region 0.084
Further Details:      
 
Domain Number - Region: 1997-2096
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0367
Family CBS-domain pair 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM221320-PA|EEB13078.1|WD
Sequence length 3546
Comment repeat and FYVE domain-containing protein, putative|DS235184.1:558048:572789:-1|gene:PHUM221320
Sequence
MNIMRKLRGSGGISTTTGDETIPNPQHTALGLNHLKKLFSEYLHPPQTLTKKELDDKLYN
MLPLFCKVFGNCPSSDMTDKFKDILLFCRVVSQLMVGEIRKRASNQSTEEASTAIVKFLE
IENSEESSNGWMLLTTINLLASGDDALVQVMTSISVPSTLVKCLYLFFDLPLMEENEADQ
DNNPHSEFTPKERRILLQKIFVQVLVRLCSHPGPAHELSRKDDLSLLFLAITSSCPPCNI
MWRKSAAEVLMTLSRHGLTQPVVSYIHNKCCMAACIENMQRAQDLTPLEIIEIFVSIFCI
LKDSSEVAQTLLEDFRSCQGYFFLSEFLLRIEHDNSREAQDAVRNLVLMISSLCMCGYIE
LKPSQASTDSLFQMAGFNLPQPSGRGVSVRNIQAFHVLQSIFLKSNSSALCSVILDAISS
VYHADNANYFILEDQHTLPQFAEKIYTKSQEIQDKFFQLLEFVVFQLNFVPCKELISLSI
LLRSQESVTCSITCMKTLLNILRYNLIFKDVYREVGLLEVFVTCLKRYAALLKEKQQAIE
EGKDFQISESNEKLGFLVMETLTHLLSGNSTNANLFRECGGARCAHNLVPYMECRHQALG
IVRELVLTGGGDDDMGTLLGMMHSAPASHILFKFHILQSLLSCLRESHKTRTGFRKGGGF
VYVMSVLVSMEGCLSDEPQPPWNTILKKKIFGLLHMVFSSITVPMRFEPANAKFFHQEIC
TQSLCDTIKLLGCFSTETELLDSSELIVAKEEPSFHALFTGNILNPTIPEHIPLRLSYQC
LVLRLLYDVALDAYDKNINYANVSYRSPSHGSKKKPNYQKLTDSPGSSRRTPQVSSLNLV
QSYTEPVIVHSDIVVAMLHLIPCIYCSNYPQVSLNLQMFAAEILKSLLRSERNQQLMCES
GLPGDLLKCCRIALEEEAHPLHSPLQYILKRLAAQNIEPKDLREFLRLGDPLNCVSMDDI
ESVINSRPSHRIPGGPVPLTRIKTLVSMTTPRDFSSSGQNYATSPAFVELDMSAEGFGCL
YLPSIAPQSPAGPGVVTGALLSVDNNVVGGIGSGDRIFPPQTGLSFSTWICIEKFSDPRT
DPHSVRLLTIVRNFQGRDEHLICLAVVLSARDKSIIISTQETLLPQTEWEPELLGEGCGK
IRCPDMFQEGQWHHVVLVLNRAVLKNSTFSMYLDGQHVNTIKLHYISQNPGGGAANLTVA
SSVYAYIGTPPCWRRYSRLNWKQGPCHLVEEVLNLQTVVTIYKLGPQYTGSFQAPQLNGS
DLLAPLIYEEKLIFGLNAKAVSNLTLAKIRKVYKRADNKSIAKQLGMTSHENATPIRILH
NSCGHLAGPARSLGGVVVAYLGVRVFSPRPVAKMIDNIGGCAVLLGLIAMAQDVESLYAA
VKALVCVARANKNIQLEMDRKRAHQTLAMLLKKKRHLLNSHILHLAFSLVGTVDSGRESS
SIPDVTAFQDLLCDLEIWHEAPGDLQKSLLEHIYELVTESSEKKINIKIARDLKLVPRLL
YIIEDITSGSTRQITLSLLGALLAQPRDSDLLRFGQFLVSTLPVSTSGVVEKNIDLKDAS
EEHAKLINNIGLRNRCLQLLHSLLFGSKNNVNISFCEDFSRILGLDWILLFLQGHLHSTT
VVWGFRILIVTVSIPTLIAKFREGTGNGGWIKDCEMVLQSKLGVPFGYQIRASASSPKLL
HNRSEALSVPGFQSLSWLLPKHIDVPEVYFLLIALMMGQPVKLLPVDSKLDLDSVWNFLF
GTNAKDGIPILSSKIPLCPEAVITILAMVRTMLNQENKSPESLPEWLREYPVTIIQFIFF
LYHNLRDLMPIFMSGDVLNALSSTLFPRSNPDSKSSTPEDCKGLEDVVFVRSDSQEVELT
SHPAKKLVLDFLRVIVVDSLSLPLIVNNKSPPVIDLVLEASPDDCTMQQQARYQTEILST
LMDHLLAADVLIGDHAALPIVSGGNLSNIPHNVCYLSSRIVDKLWQGTLSKDPHEIFDFI
VKLISQAKRRSTNVPLEGLYHCLNRTVLFLLSRPTNSISQQTSVLEALHKLTTHRVLIFG
VGNHELDFIGCLTYCLIQLNSDMKIVLDTNMKTMWHVNPVNAEENLTAQQAQNLMSVAAR
RVWEELFIYKKPAIEEVFKIPLNTANNKVPDLLSVREQVVEPATKLWLNYIEAERKSLHR
VPWELQNQIQSKIQKVTGGLTRLASRTKVKKEEIIKVRRSQISFSEVFDWVQSQTSLVKE
LVEARLKNHYLGQEHMLKYMLEEWTLMQTELTRERGLWGPILPIKLDKWMLDMTEGPCRM
RKKMMRNDLFYLHYPYRPFMDAPDNKALKYKVATSWDSKEYFLKKRFSHNWFDSEKDLIF
DSQDVTPSVPEDLKEANSFQAMPLNRTVSDPDDVLEDAENDSGNVDETPQPDNQTLIRLL
EDNEKISHMFRCARVQGLDTTEGLLLFGKEHLYVIDGFTLLKSREIRDIESIPENGNYEP
ILPSTGSPRRSRAMRQCSKFSYDDIREVHKRRYLLQPMALEVFSGDGRNYLLAFPRKLRN
KVYQRFLAFATGIADSAQQSVAGQKRTANVEQATGILSSLIGETSVTQRWVRGEISNFQY
LMHLNTLAGRSYNDLMQYPVFPWILSDYDSEELDLTHPSSFRNFSQPMGAQTLDRLNQFK
KRYKEWDDPHGETPPYHYGTHYSSAMIVCSYLVRMEPFTQHFLRLQGGHFDLADRMFHSI
KEAWLSASKHNMADVKELIPEFFYLPEFLCNENNFDLGCKQNGVELGNVVLPPWAKNDPR
EFIRVHRQALECDYVSQHLHEWIDLIFGHKQNGSAAVEATNVFHHLFYEGNVDIYSIDDP
LKKNATIGFINNFGQIPKQLFKKPHPAKKLGGSKSFVLDATGITNLSSQDKFFFHHLDNL
RPSMQPIKELKGPVGQILSVDKSMLAVEQNKVLVPPTFSKYVAWGFADHSLRIGTYDSDK
VLLVCEEPFGEIVCCTCPSNRLIVTAGTSTVIKICELNKKSLSIKQCLYGHTDAVTCLTS
SPAYNVIVSGSRDQTAIVWDLSRMIFVRQLTGHSAPLAAVTVNDLTGDIATCAGTWVHLW
SINGDELACVNTCVARADRMQQILCVAFSTTNEWDSQNVIITGSSDGVVRMWSLDYVQVP
ITEKQNTAKSVVVEEEDKELKEGEDVDENVRENESDNDKRRKRMKNLVEQMSVSAEQTTT
TEEGGGHLVKSGSESSLSEDDKINTKENAEEEEKERCSGKEDEDDNYNDNDNDKNAKLAC
DLEFRKRLSIDNKSKSEEIRTTASDDSSCNKWRRSSCKDEVVSSDVENDLKSDSSKKDSD
VSSKPSPVVRRRRSSAARNPEFRKSEGCSPASEKSKSDNNNKSTSHEDPGVNCEDGNKIR
SSKSDTSLTDSFVMVENNGGLSAKDGRCNHHLQNILREGFRWQRQLLFKAKLTMHTAFGR
KDNTHPASITALAVSKDQKTVFVGDTRGRVFSWSVAEQPGRTMADHWLRDEGAESCVGCG
VKFNIYERKHHCRNCGQVFCSKCSRFESEISKLKILKPVRVCQNCHKSLSKQKQDNNKPP
SHVVNS
Download sequence
Identical sequences E0VI72
vb|PHUM221320-PA|EEB13078.1|WD XP_002425816.1.24195 121224.XP_002425816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]