SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM226100-PA|EEB13140.1|FYVE from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM226100-PA|EEB13140.1|FYVE
Domain Number 1 Region: 471-673
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-47
Family DBL homology domain (DH-domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 666-783
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-23
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 804-874
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.78e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 827-997
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-21
Family Pleckstrin-homology domain (PH domain) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM226100-PA|EEB13140.1|FYVE
Sequence length 1001
Comment RhoGEF and PH domain-containing protein, putative|DS235196.1:34404:38513:1|gene:PHUM226100
Sequence
MSSPNNVNYETNNNNNNNNNNLTKLKNVKPPLLPKPQIIKLESGNHRVIKSNPNSPEINS
NSKIDDRKSSSYSVQKTMKYQNDKQSHKPNSKPPYISPKPQLPSKLHVHELNSETVNNTN
LYNNVGSKVNLNNDSIENKLTTETSTSYEHNNSGLGLHTTSDNQDLHRVSLDEKFKNPIL
GKNGDLNQTVKDLFNNPEQLTEFCKQVEMCSKHSHLLKYNVDTTANCQKWEKNLDELDLA
LKSPKSFLHSYTNSSNQIKENVIQNCEKSEKKKNDNVSSFLYKNTINCSFKVNKNKRSGQ
EHNEMTSDNFNENPINDNADNNFNTDKKRSLKLDTTKKTDEYVPGGDTSNSDGSSFSKRF
PWFGSFGKGNKKENRQKERCVSQFYASSNVKDSIFHEKNRTKSLPNIKHPRVVSDVNNTS
DKSHDSRNSSQHLRVPNFYPHSDSDDDKDSVNQIEISFTDKDCNSSRAFLKAKELMTSEE
VFIDVLKLLNVDFRNFVQMKNHETKNSCIPNTEVNKILNHLSQLQSLNEDILEDLRKRIE
NWDTNPKISDVIVKKGAFLKMYTTYIQNFESQTNYLDECMIKYPKFGKLVKEFESSDKCK
KLSLKHYMLKPVQRIPQYRLLLNDYLKHLDEGSVDYADTVSALNIVCDVVDHANRNIGHG
DKEGRLMHFQSLLGEYALIKPGRALIKDGPLEKICRKSVKDRYFILLNDCFLHTTYSKQY
LKIHQELPLSGMKVCLNDDEKYSNSFTVHSIKRSFILCAKTESECKDWVEKLHGAIEEHI
KKQKTFLNVKIEMSDSFKLGKEAPVWVPDGKVTMCQICTAEFTALFRRHHCRGCGKVVCR
NCGSNQAPLQYTNFKSDRVCDQCFDLLLKGVQNEYLYIKSKFVKYSSAGNGKKPKYIPPR
LKEVSANDSESSMSGWLYRKSRKSWKMFWYVLKDHVLYVYKASEDVLALETIPVLGYEVE
RAKVNFEEIDKNLIFSLVHSSQMPLIFRAESQTSADRYLNN
Download sequence
Identical sequences E0VID4
vb|PHUM226100-PA|EEB13140.1|FYVE XP_002425878.1.24195 121224.XP_002425878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]