SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM227940-PA|EEB13187.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM227940-PA|EEB13187.1|predicted
Domain Number 1 Region: 980-1277
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-38
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 450-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-19
Family Extended AAA-ATPase domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM227940-PA|EEB13187.1|predicted
Sequence length 1337
Comment protein|DS235200.1:87818:94269:-1|gene:PHUM227940
Sequence
MGSSCSSRQEHKDKDSVSTKSEESPAYQIIIKKNTEDDESKFGENKPQTGLILKPTELPS
EEYAKPRNAVTSISDSNSLPSPPILSPKEITEPPLLPDELTQLPESFQNLITGRIAKHSL
NFKSRKIVLYVCAADSQDCCVEKGVLHQVVGPELRNYCRDKGYEFHITDLHWKTGLEKQQ
DHEFPELCLEELARQMEVGYIIPVLFLSNSLGTPLLPKTVETQDFEMALSQAEDKDSLKK
WYRLDSDAQPPCYRLVPVASHIPGFKENSWKEREKALEEWRSEIEKTLTVMISAFSEELR
NTYLTTVVEQEVHNTILMSQELARRCLWLYRVFTQKPESTQTLSLLAQEQKRRLDIVYKE
LRSQLTEKHIVRVNVKWNQDGIVDKNIPEHVQYINDVTSHLTKYLKATIFTIIEEDQSKA
VIRSMFGIEAQFLNEIKWQALFCQKAVQSSVMREEILQSIQSYVTSDSTSPLLIHGVQGS
GKTTILSRAVHCIQTWLPDSYSLFRFAKISELSYTLTDILKTVCDQLSLLSNGHQTFCNY
NTNTYGTEFSKLITTSSFQRSVVILLDGLDHLKNLNLEWLPWKLPTNVKLIITARTESSL
YNKFKSNLQSNNFLIEIPELSKSEAERLLLSSVSQYSHSVSSKAAQRVLSVLQFCRLPLY
VKVLAWRVSWFTEIEHEFDPKVNLKEEMNSMLDYVDAMLDSNRVKMAVSLIVASKYGLRD
SELLDIFSNQTIFHSEKTYLRWAPACLFLSRFLKYLNPFFQWVSDGNNLTLKISDNTFEE
IINQRYVKENKIYSQLIYEYFKNEKFNSIEKPANQLKRFDISSYKRKLIELPYQSIILNY
NTVDDFLLNEKWLYDKICGCGVFQIIDDIKEINGKFDISNDLLLLQNILENNHKALNYDG
RQMYTYFFNELNSKCLNESHFWESFYKKIINPPINSLMPVNKETLRVSDFSQSPFENTKN
NQQESNENINLILRLIDNPNFMVSVSTKQEEIAVWDLFTCEKVRSIKGVTHPTSLQLIDD
YRAVVLCCRELRIYNLDDGVLVTRLKGVMNQKMAFFGLHDKNHLVTLSRNRMYVNLMNLD
NGDCITTFKAGEDRFLNSLLVSGDGRILVCGDETQKPFPLLVWNLSSRKLLYDLRIPHHD
FITSLSAITHEGHYVCCVAKEVIEPGPNFIVVYDLQNGTLFKKWKPGVDTTSLDISSKDS
CVISGLADARILVWDLVTGNCRWSFRGHSAPVTLVRKDPCGGSFLSADILNRDRSIRIWD
LIKGELLAVYTPPKPFSACELGKGGKMVALTLKGELDIKSLILKGPEIEEIGENTVPYGK
VENNGKTFILTENQEGR
Download sequence
Identical sequences E0VII1
vb|PHUM227940-PA|EEB13187.1|predicted 121224.XP_002425925 XP_002425925.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]