SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM229890-PA|EEB13243.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM229890-PA|EEB13243.1|histone
Domain Number 1 Region: 181-458
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.93e-112
Family N-acetyl transferase, NAT 0.0000000242
Further Details:      
 
Domain Number 2 Region: 13-94
Classification Level Classification E-value
Superfamily Chromo domain-like 1.98e-20
Family Chromo barrel domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM229890-PA|EEB13243.1|histone
Sequence length 468
Comment acetyltransferase Tip60, putative|DS235201.1:98918:101438:1|gene:PHUM229890
Sequence
MLSEEYDDPDAICESSASLVEGCRLPVRMRLGDDWPLAEIISIKDIKGIMQFYVHYVDFN
KRLDEWVTEERLDLRKVQFPRKDGTKETGCATPKRIGLGGGQIPNSGGSVTPQPVEKERQ
ASRPTSPVTPIQSDFISGSTRKGTFTESETNCVTDSLDGSPAAPRLTGSMVAHGSDDVVT
RMKNVEMIELGRHRIRPWYFSPYPQELVTLPCIYICEFCLKYTKTKKCLERHLAKCNLRH
PPGNEIYRKDTISFFEIDGRKNKNYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTDYDNR
GFHIVGYFSKEKESTEDYNVACILTLPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLS
DLGLLSYRSYWAQTILELLITAKPIGENEKPQITINEICELTSIKKEDVISTLQNLNLIN
YYKGQYIITLSAETITTHMAAMDKRKIRIDPKCLHWTPKDWSRRVHKW
Download sequence
Identical sequences E0VIN7
vb|PHUM229890-PA|EEB13243.1|histone XP_002425981.1.24195 121224.XP_002425981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]