SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM231170-PA|EEB13261.1|1-phosphatidylinositol-4,5-bisphosphate from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM231170-PA|EEB13261.1|1-phosphatidylinositol-4,5-bisphosphate
Domain Number 1 Region: 314-577
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.56e-101
Family Mammalian PLC 0.000000386
Further Details:      
 
Domain Number 2 Region: 142-312
Classification Level Classification E-value
Superfamily EF-hand 3.29e-52
Family EF-hand modules in multidomain proteins 0.00049
Further Details:      
 
Domain Number 3 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 766-913
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.27e-32
Family C-terminal domain of PLC-beta 0.0039
Further Details:      
 
Domain Number 5 Region: 600-714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.54e-24
Family PLC-like (P variant) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM231170-PA|EEB13261.1|1-phosphatidylinositol-4,5-bisphosphate
Sequence length 913
Comment phosphodiesterase, putative|DS235201.1:230848:237437:1|gene:PHUM231170
Sequence
MTKRFEFNWHIPVPEPLLSGGVFDRWTEEKDSTDFETGCLFKVDEYGFFIYWKSEGKEGD
VIELCQVSDIRAGGIPKDSRLCSQLINKHGHQLEEKSLTICSGTDYININYQHIICPDAA
TAKIWVDGLRSITHNVKANNFSPFTCLLKHWMRLGMLVDPKGKVSVKVVVRTFSSGKTEK
LVYQCLQELGLPSGKNDVIEPSDFTFDKFYALYHKICPRNDIEDLFQTISQGKAESISVS
QFITFLNEKQRDPRLNEILYPLYDEKRAVEIITTYEQDETARNEKRLTKDGLIRYLMSDE
NAPVFLDRLDIYMDMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGRSEDEEPIITHGKAMCTDILFKDVIHAIADCAFVTSDFPGQFIISDDEPKEDARAA
IVPIPEEKKEEVGDIVGEIPEIPPVQIQYTGSTTNVHPWLSSMVNYAQPIKFQGFDVADK
NNIHYNMSSFVETAGLGYLKSQAIEFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQ
MVSLNFQTADLPMQLNQGKFEYNGNCGYLLKPDFMRRSDRSFDPFAESPVDGVIAAQCAV
QVIAGQFLSDRKIGTYVEVDMYGLPTDTIRKEFRTRLVPSNGLNPVYNEEPFLFRKVVLP
DLAVLRFGVYDENGRLLGQRILPLDGLQAGYRHISLRTEANFPMSLPMLFCNIELKIYVP
DGFEDFMAALSDPRAFMSAQEKRAQQMKAMGIEETDIKDLKDGEVEDLKLEPINVDVLKS
EKGFQKTAKKQQKEIDILKKKQMKEKGLIEKNQCSAVEKVVKGRDKNDLTSDPMILKLVN
EQTQQWSEMQERHRKEEWELLKQHVLDQQEILKKLMKASQASQIKQIEAKHERIKEMNSR
QAKISVETMKEVK
Download sequence
Identical sequences E0VIQ5
vb|PHUM231170-PA|EEB13261.1|1-phosphatidylinositol-4,5-bisphosphate XP_002425999.1.24195 121224.XP_002425999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]