SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM231400-PA|EEB13264.1|voltage-gated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM231400-PA|EEB13264.1|voltage-gated
Domain Number 1 Region: 219-381,418-480
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-43
Family Voltage-gated potassium channels 0.0059
Further Details:      
 
Domain Number 2 Region: 482-670
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-40
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 40-136
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-20
Family Flavin-binding PAS domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM231400-PA|EEB13264.1|voltage-gated
Sequence length 1150
Comment channel, putative|DS235201.1:245061:251463:1|gene:PHUM231400
Sequence
MPGGRKGLVAPQNTFLENIIRRSSSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAE
VMQKSCRCTFMYGELTDKETISRIDECLESQLHDQFEILLYKKNKTPLWLLLQIAPIKNE
RDLVVLFLLTFRDITALKQPIETEDTKGGLSKFAKLARSVTRSRSVLVSQFSSHLPNLKD
TNKQSHLAHMMSLNADVMPQYRQEAPKTPPHILLHYCAFKAIWDWIILCLTFYTAIMVPY
NVAFKNKTSEDVSLLVIDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRTNYFKSWF
IIDLLSCLPYDVFNAFDHDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLL
CFYMLVAHWLACIWYSIGKSDTDNGVQYTWLWKLANVTQTPYTYIWSNKSGTPELIDGPS
KKTTYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQM
TSATAKYHDMLNNVREFMKLNEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKA
DICVHLNRKVFNEHPAFRLASDGCLRALAMHFYMSHSAPGDLLYHTGESIDSLCFIVTGS
LEVIQDDEVVAILGKGDVFGDSFWKDNAIGQSAANVRALTYCDLHLIKRDKLLEVLDFYQ
AFANSFARNLILTYNLRHRLIFRKVADVRREKELAERRKNEPQLDQNQDHLVRKIFSKFR
RDRSQSQATPVQNGLAQTSNDLEKGSEKSDSEKNYSPEGNCKVIRVLSSNKLTSVIEKDD
SSVGSGSSGSTLAPISYVKTRPTNVGNSKWGRLLGGKSLDLGTEVNTSNRSTLMRAVSIG
NGKESSNNLSTNSVCGNGNVSSGSGNKVFPRLQKVASVGSTGGSAVIMRQDTIEELVEVE
DNKVLTLRPGSVVSLAPKIVKSDVRSTPDIKRVKSFDNGSITSTEKENVCVENDQPPTAS
TTTSSTTATTTNISALPSQIVFPNAEYKEIMSNIMNFKVDVKLEVQRLNQKIGRLEDLIS
DLVLKLSDENTVREIKERKTESDGNEVYNSNGEQQQKTFGGVLLKPSCMGETSSMSAGKS
DRASVTRCSESTVPTSLILKKKKCKLRLKSTAPTVPMLSPTTPDNPTTSSPEGNRSDAED
KKNSFELESK
Download sequence
Identical sequences E0VIQ8
XP_002426002.1.24195 121224.XP_002426002 vb|PHUM231400-PA|EEB13264.1|voltage-gated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]