SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM231560-PA|EEB13270.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM231560-PA|EEB13270.1|hypothetical
Domain Number 1 Region: 11-94,125-162
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000652
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 
Weak hits

Sequence:  vb|PHUM231560-PA|EEB13270.1|hypothetical
Domain Number - Region: 186-289
Classification Level Classification E-value
Superfamily V-region of surface antigen I/II (SA I/II, PAC) 0.0759
Family V-region of surface antigen I/II (SA I/II, PAC) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM231560-PA|EEB13270.1|hypothetical
Sequence length 619
Comment protein Phum_PHUM231560|DS235201.1:283283:285269:1|gene:PHUM231560
Sequence
MNANRSSPESTPICRCRVLYMGSAVPHVTKDGLQGIQEPLKELYPEQGALGARGIDSWLS
VWSNGLLLENVDENHKKVTRFFPIESLHYCAAVRYVLVPEKASQNPSTPKFLPLDSPFAR
TPNPSHPPLFAAILRRITGIKVLECHAFICKREMAANALVRCCFHAYADSSYAKHIDEKG
SLYGNNQGNDSIDRVEIWRQTSKNNSKNGSTTTLNSHGGNLGTLRSVDQMTLGDDVSVYN
GNENHKVWAGLSSNENIYGSTNVAYSSNSMKIGKSARPRQAVTPAPPPPPPFKDDKKKLK
KEQEKKRKKNTNEYRDDANSLINHSMMRHAQSVNNLNTRGMKIPNQPVYSNGSLMRTNGF
GSTLTPNGYSNPIMYIPTTLPNHGGKKKSLLHAGTFSHRPKNVMPFPARQVPPQFVPLTS
PVPIVPFSSKKSKGIPPVYAMEEPLYMPSNRPLSPVASYQPGHFPHESYLLQQYATMENG
KKKKNRKNKVPLAVPVPIPTPMLPDGGIYMGNHGLTSSNGQGPVDVPYSPIPNGNSPLND
ESMADGSPGDDDESPFNTGIYRKKGHLNERAFSYSIRQEHRSRSYGSLANLRSEVPKAVY
ESKRLAAITAGSNNGKFLR
Download sequence
Identical sequences E0VIR4
vb|PHUM231560-PA|EEB13270.1|hypothetical XP_002426008.1.24195 121224.XP_002426008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]