SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM238300-PA|EEB13395.1|voltage from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM238300-PA|EEB13395.1|voltage
Domain Number 1 Region: 1325-1501
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-27
Family cAMP-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1820-1984
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-25
Family cAMP-binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 280-448
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-24
Family cAMP-binding domain 0.0055
Further Details:      
 
Domain Number 4 Region: 815-995
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-19
Family cAMP-binding domain 0.0079
Further Details:      
 
Weak hits

Sequence:  vb|PHUM238300-PA|EEB13395.1|voltage
Domain Number - Region: 1585-1750
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0018
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM238300-PA|EEB13395.1|voltage
Sequence length 1994
Comment and ligand gated potassium channel, putative|DS235219.1:207777:214040:-1|gene:PHUM238300
Sequence
MDLARINELGLEDYSKWKSIVLVISFSKWWIMIITFQCYLVFLICISQLGFHFYKTELAV
LRYIFDAFYFLDVVFILSYRRNIQYRKIKFTAPRNWFFIFLDFLSIIPAELFYSFYYVTN
NENDDLERILFQNRTLRIYRIFYFESLVEKTITKYHNYILYMIFLFVTKVILVSQIICCL
WVNMKNSLKCDLSSYTCLLWHMLEVQSIVIHNSSLKYGSMTSTWEIVLAALAMFFGLVLI
YAYFYPFIFLVSIQLNYARALYYDKYKRLVQVLDNMIKNQSVKEKIIQNFLDSWKNTTNV
HQLFENVPLALKKEIFTDIFWDAFSHSDLLRSISRSCKRTLSLVVTKVNYHTGEQIYVKG
QNREKMLFLIQGMVQIMAEENEKSPLLSFSSGTVFGESSLFLCTKSSAIIKCMTYCEFQI
LTMQNLAKVFIDYPKDKILVFKKLKERLKMAKYTQWRKTTFGFDDSREAYNIQSNVEDCV
KWIKTQWVAISEGHIRHKLTMKAIEEGQRIPSFHRTLLQPEIKIEFISNYLELFVLSNAF
EEKRDAVCLRTNFPWSIDPTASFLRSWNTLIKFVSFFPMIVYPFSTAWLDEYPILVYKLS
FVVTTIFLVDVVLKLLTAKKTKHNIITQFRSVLLQKLREPTFYLDILAAFPYQIFIILKY
NELKSYEVGLFLYPAILKFHVFVTVKIPLGSYMVFMNFLKNFIIYLVCVYFFAAGLHIYY
YSLEVRNGPKENWITRYLSGKGRKNVRVQLVSFINVLLNALGITDLYVYCEKTMELVSES
TQKYVFFLIIAYFLGNFFGCFIIKIFSFGTFIVLLKRIRAFIESIRFSADVEKQLLKNFK
FQWDYEHADNFSSESPILKFSSFDIKKNIFLESIYHTLKICKMFQLESNDLLMAVMKKCS
FVGVPAGSIIVTYGDISHTLSIVHRGTCQVNSFLIKDTTAGLGWPMAVGPGYEFPVLSTL
CGTPVPVGVITITDCELIMIHVNDLVNIFIHFDMLKDVTEALIENNFVEKLQNVKPGLIG
VKENLFKKVFLTKDRKESLWSKKLWSIYFFFDRGNRYNSLKFFEKWELFFGIYVILLNIF
WPSCFGILAYASHVLLPMLVASQIVIVLNILFYIWTPYYNDNGILVYHPFYTLKHYLNTA
LTVDLLCFFPFYSIVRYGISDSMEKLPYWTVLFSLFQYYLKFIHVIGFFGRDSLTLYDKY
FVHMAKIILFFFITLNIHINFCMFYFAEWIYESPYRIVDFEVVPDFEEYYDNATFRPNGS
LHEYYIYICYWTISSLNANNLNLEIFREFQLKMSFVLSLIGAIFSYYVYCTMVADCFFTF
LGEIIFQEKITSLVKFLEFENADDKVIERVLSYYNYVWSKSRGENLKKTFEQFPSYLHDQ
LVYPLYRSTLIKCNIFSNANEGFYKILANHLSCVYYSRGSVIIFQNEVQSHLYFLHKGKC
FVYDWFLILTDGSLIGDLNHTGVMRNKIYALTHTELLKISSNDFFSILNNFDTIETQYLK
VIQSLENFFNSGVVKNKYQAHPVDSRDVLHAFGLESKVFGFEDESYFEETNKVTIVIRKS
LKFRSDEKKRLFIIYPGTWKIKILLTFVQIIAFLSISAVPFFGIFGCLTNEAFSVIAILD
LCWLLCIICNFFVGYMDKVKGDVITDLKFIALKYMKRGDGFFIDLLALIPFEILYILTFK
NLRDVNSKVVSWLRIFRLFRSIHLFGDIRNESKKLKANHLLIYLHLLLYLLVCLIFLSAF
IVIITPYPDDHVVRNPFSLNIRQIGVFLSACEDILDFFSSTGVSILYPSTNIHIFFMIIF
GMLVPYLKGILISQDNETSPSIIKSVVDYKLNLLDFGRSENMPLFLEKCPLSLKIIIMKD
LYFKHLLKFPLFENINTIFLEQLLATMKREIFFSGQAIVEQFDVDHRMYFIHKGEVYVIK
EQDYMETVIGIRKSGEYFGESSGLWFSIPHEFTYRARTLVEVLVLCSDDWMDLRRCFPKT
SAEILSKAQSLGLI
Download sequence
Identical sequences E0VJ39
vb|PHUM238300-PA|EEB13395.1|voltage XP_002426133.1.24195 121224.XP_002426133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]