SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM240840-PA|EEB13460.1|Oxysterol-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM240840-PA|EEB13460.1|Oxysterol-binding
Domain Number 1 Region: 375-731
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-108
Family Oxysterol-binding protein 0.0019
Further Details:      
 
Domain Number 2 Region: 9-120
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 753-794
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.00000523
Family Oxysterol-binding protein 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM240840-PA|EEB13460.1|Oxysterol-binding
Sequence length 794
Comment protein, putative|DS235221.1:98582:108721:-1|gene:PHUM240840
Sequence
MSENNANVTEVEMNGWLFKWTNYLKGYQKRWFVLSNGLLSYYRNQAEMDHTCRGTVSLHS
AIIHTEDSCSFVINNGATRTFHIKAANEVERQKWVTALELAKSRAIRSMETEEEEEYEKS
SANHKAQLMEAINTLSAKLKNLQVCSELIEKHGTALQRSLSELESLNTAQDMSVKIKAVN
ERATLFRITSNATLHACSEYLDLAQSQGKKWQKMLQHERDQRQRLEEMVEQLARQHSNLE
QAAKDHRLPRQTASPSDEDDGNEFYDANCEGDEDGEKNDFILKIPIGHRRTSSGISQDSQ
VLQLQLLLLLLLSKSIIRESKRKSFFISVLNMADEKVPRFKYLIHSLELNEKIVGAIAPP
TTSSKKRRTRVPDKPNYPLNLWSIMKNCIGKELSKIPMPVNFSEPLSMLQRLTEDYEYAY
VLDKAATCNDWEQLAYIAAFTVSSYANTANRTGKPFNPLLGETYECDRTDDLGWKAISEQ
VSHHPPMLAQYCEGKLWRCWQEFTMASKFRGKYLQVIPLGTAHLTFTNSKNHYTWKKVTT
TVHNFIVGKLWVDQHGDADIINHTTGDKCHLKYLPYSYFSKDTQRKVNGCVMDKKGNMKW
VVNGEWDNKIEIAPVISASNNCAVVKTGPYILAWERKMPPPDSEKYYNFTEFACQLNEPE
PGVAPTDSRLRPDQRLMEKGDWDGANAQKVRLEEKQRETRRKREEEAEEAANKGEWKERK
KKKKKKLIDLNGIGEFSDILTRPFRFLGQPYPVYQPLWFRKEEDPITGSLAHVYTGKYWE
AKAKNDWSMCPNIF
Download sequence
Identical sequences E0VJA4
vb|PHUM240840-PA|EEB13460.1|Oxysterol-binding 121224.XP_002426198 XP_002426198.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]