SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM244140-PA|EEB13509.1|Ras from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM244140-PA|EEB13509.1|Ras
Domain Number 1 Region: 551-858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-79
Family p120GAP domain-like 0.000000047
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily SH2 domain 7e-25
Family SH2 domain 0.00063
Further Details:      
 
Domain Number 3 Region: 137-270
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-24
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 4 Region: 304-416
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-20
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 5 Region: 430-562
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-17
Family PLC-like (P variant) 0.022
Further Details:      
 
Domain Number 6 Region: 95-146
Classification Level Classification E-value
Superfamily SH3-domain 0.000000351
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM244140-PA|EEB13509.1|Ras
Sequence length 874
Comment GTPase-activating protein, putative|DS235222.1:297412:301345:-1|gene:PHUM244140
Sequence
MLLFPRWYHGRLDRYTSEQRLTQASRQGSYLIRESDRKPGSYVLSFLGKTGINHFRITAV
CGDFYIGGRQFDCLSDLISFYTNCSDLLKRERLLFPVPPPVPVNDKKKVVAILPYSKMPD
TDELTFEKGEIFFVHNDMGDGWLWVTAHRTGEQGMIFTELVEDLDQNIDPNTVYSWFHPQ
IPKNEAIDMLVKAGPGSFLVRPSDNSPGDYSLFYHINNQIQRFRIEKRGVRYLMGGRTFD
CLDAVIERYRREQIVEGHTLMLPVCRKLSESDGQVIMVSPKEVQHADKIYETLRECREQS
GLKKNKGIKLQGYLQKRSDKSKRWKLMYFVLLNEGTDSHLYFYESPKRTKPKGLIDLNCS
YLYHVHDSLFEKPNCFQLVERALPCLSTITYLSSNSEDSTQEWITSLKQLCITQFAKPSK
VDRLREIRCLQINVLSAHRLPHKLVPNPFCVISLNEVKVAKTKVMTGPDPTWDEEFILDD
IPPDILSFTVSVHNKGKRSKNSEVSEITKELHSLKNGEEKEDWHTLSGITPIGEWGMIKL
KTKYVHDLIMPQEEYSPLQELILDPSLEVVRSLAEICHSDRLPLANSLLKIFRAKHKEAD
LMTSLNDLEIEREEETSTLFRGASLTTTIMDLYMKSICDGFLQASVQEIVIKLLEAKQSC
ELNPSKMNSPDDACSNAEFLLQILDEVTHAIFTSADACPKTLRYICGCLQRSVVNKWPNE
RLVKTRVVSGFIFLRLLCPALLNPRQFNLIPESPPQMASRSLIMVAKCLQNLANLIEFGG
KEPYMEVVNPFILKNKERMVVYLDHLSNCPEKPPSEDKVIKIDLARDLGTLHNICVSHFK
ELQEIAKTKNTIKKLITVTEMHSKHKQRYLEMIK
Download sequence
Identical sequences E0VJF3
XP_002426247.1.24195 vb|PHUM244140-PA|EEB13509.1|Ras 121224.XP_002426247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]