SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM248220-PA|EEB13589.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM248220-PA|EEB13589.1|conserved
Domain Number 1 Region: 58-165
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-25
Family SH2 domain 0.00062
Further Details:      
 
Domain Number 2 Region: 454-666
Classification Level Classification E-value
Superfamily Ras GEF 9.02e-22
Family Ras GEF 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM248220-PA|EEB13589.1|conserved
Sequence length 792
Comment hypothetical protein|DS235226.1:163266:166763:1|gene:PHUM248220
Sequence
MGGKILKNDDDDGGGGVREDLGAQEFILNVIQSKSLGNIKMEANPENGLDPAQLRKALEW
ELSLDARDLRSHAWYHGSIPRTRAEEILESDGDFLVRDCTSQPGNFVLSTKCKGQNLHFV
INKVVLQPDTVYERIQFQFEDEAYDTVSDLITYYVGSGKVISSLSGARIQNPKNRLHPLS
FYATKYSVYQSSGYSVSPQPSPSNPSGNWKYNTINNAQSSFLTLRQKHDTPPKLPNKQRS
LSLTPSELNGKLQMLHCGNDKSNSADGVIQNMNSNCGRFATNSLPRGTKNKDILVNNEKG
TTTRNSKLSRVTSDPSLSPCFERRNATGESTGGGTTTTTTINNPPPKPSRIPSLPGGVET
IIPNKENNNNFYKVTSSSYQASGSDSGNGSGDSAQSSATGDSNEVTTLCGTGGGTISRGV
IIKNPRYHYDKSNVPNSASTSTLKGLEFDPSTEEYLVNLLPKIDLGTAFDVENFQTLLLP
TLENKPVDSSTLQCVKNMLRENGSRILANHMTRVDLEITIGEKTGIKNWSELGLGISSGI
EMCSLPQGQQVRLDIIERVECLKLLVAVTVLTCKNESERAETLHKWIQVAIDIKTALGNL
FGFAAIMLGLCLPQVQRLAATWHTLRQKFTDSAFNYEAKLRPTLKSMNECTNPQAPNTTI
PYFIPFVLLQELTLDDVLGTNTKLDGSLSNECLAVFESSSMDSGMSTMFAHLESGRKFST
MLPSYRRNADIILGDSKIDELITDMFRTEFHLKFLWGSRGATVSSQERHAKFHQVLNVMS
EKCEPSDEIGKV
Download sequence
Identical sequences E0VJN3
vb|PHUM248220-PA|EEB13589.1|conserved XP_002426327.1.24195 121224.XP_002426327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]