SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM253760-PA|EEB13705.1|dystrophin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM253760-PA|EEB13705.1|dystrophin
Domain Number 1 Region: 390-514
Classification Level Classification E-value
Superfamily EF-hand 3.34e-38
Family EF-hand modules in multidomain proteins 0.0000421
Further Details:      
 
Domain Number 2 Region: 515-608
Classification Level Classification E-value
Superfamily EF-hand 1.18e-34
Family EF-hand modules in multidomain proteins 0.0000535
Further Details:      
 
Domain Number 3 Region: 591-677
Classification Level Classification E-value
Superfamily RING/U-box 3.65e-24
Family ZZ domain 0.0077
Further Details:      
 
Domain Number 4 Region: 54-181
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-19
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 5 Region: 211-347
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000132
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 6 Region: 357-389
Classification Level Classification E-value
Superfamily WW domain 0.00000000519
Family WW domain 0.00086
Further Details:      
 
Weak hits

Sequence:  vb|PHUM253760-PA|EEB13705.1|dystrophin
Domain Number - Region: 790-876
Classification Level Classification E-value
Superfamily Prefoldin 0.00497
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM253760-PA|EEB13705.1|dystrophin
Sequence length 952
Comment putative|DS235235.1:57135:65587:-1|gene:PHUM253760
Sequence
MDKLHHDQVGNVACYDFVHVSEKKSQTPSVGAVELGLGGTADLQSEIESHRDVFSSLNGA
GKKLLGSLASQDDAVMLQRRLDEMNQRWHHLKDKSMAIRNRLESNTEHWNALLLSLRELI
EWVIRKDTELTGLGPIGGDLASLHKQQDDHRAFRRQLEEKRPVVESNLLSGRQYIANEPA
LSDTSDSEAGRELDGDSRGYRSAEEQARELTRCIRREVNKLSEKWNALIDRSDQWQRKLD
DSHGKMRILVKGIEDVSTRISALESSKAQWIIPSEASQAPELLASLRQYGENLTPLARIV
DDLNDQSALLSASNVLVAHSTRTRLDDINMRWKLLQLAVDERYKLLSEFGRDGGLGLLSA
SVESPWERATTATKVPYYINHEQETTHWDHPKMLELMTSLSELNEIRFSAYRTAMKLRAV
QKRLCLDMIPLSAALEAFDNHGLRAQNDKLLDVPDMVTVLRSMYEKSNDKSEKLNLPLVL
DLVINWLLNVYDSQRTGQIRVLSFKVGIVLLSKGHLEEKYRYLFRLIADPSRMADQRKLG
LLLHDCVQLPRNLGEVAAFGGSNIEPSVRSCFGPDKEQIEAVHFLSWVQQEPQSLVWLPV
LHRLAAAEGARHQAKCNICKDYPILGFRYRCLKCFNFDMCQNCFFSGRKAKNHKLNHPMQ
EYCTTTTSGEDVRDFTRALRNKFKSKRYFKKHPRVGYLPVQTVLEGDALESPAPSPQHSM
LPHQEMHSRLELFASHLAEVEHRKRSNSTPDSEDEHQLIAQYCQSLNGRIGDSSVPRSPV
QVMVAIDQDQREELEAMIRELEEENATLQAEYERLRSKQTPGSTPEEINLSGNDMIAEAK
LLREHKGRLEARMQILEDHNRQLEAQLQRLRQLLDEPSNNSPSKTGTLQTRSVTASQLAT
DSPAKVNGHSNGPGGGKWERPLPPPPPNGHMPTSGSAHNVGNLLHMADVVSI
Download sequence
Identical sequences E0VJZ9
121224.XP_002426443 XP_002426443.1.24195 vb|PHUM253760-PA|EEB13705.1|dystrophin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]