SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM257830-PA|EEB13775.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM257830-PA|EEB13775.1|conserved
Domain Number 1 Region: 814-920
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000448
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 25-240
Classification Level Classification E-value
Superfamily ARM repeat 0.00000384
Family PBS lyase HEAT-like repeat 0.077
Further Details:      
 
Weak hits

Sequence:  vb|PHUM257830-PA|EEB13775.1|conserved
Domain Number - Region: 198-341
Classification Level Classification E-value
Superfamily ARM repeat 0.0777
Family Clathrin adaptor core protein 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM257830-PA|EEB13775.1|conserved
Sequence length 934
Comment hypothetical protein|DS235239.1:174553:178712:-1|gene:PHUM257830
Sequence
MHDLFTQVLGKKDLSKAGDLFTVSDIEISNDLSEVIKTILDITSNSDYVNNDNDQSVVEI
CITRVTSAIRETGSMESHADALVELLQNCLNHSLKPTSKDEDPPHAKIAADIISCIFLAK
VMKKALPVAVKFLHKGNKELSRNMSSYLSLAAIENAELLSQHIQLIIDSIISGNYTLSRV
LPQVYGVDKDALEEHVMALVSLLPLCNDSEKLALLNLFALIANNKPALLELSLHQLCEYL
NLCSTAPVAMQIFLNVAEKKPQSLIDHLPRIKLCADRFPNTLCLAAKVISLVGKLSKDRA
EDALNFVLEHLQKADRGSQGTLLKEATLLCSSYPVLFTEKMLEEVRQVGIANEEKNSNSN
SDSSNNNCNADSNSPNKNGRHNENDKENDNINNNNNNNINKNSNDSDESQVNQTSGNVTI
VKLGGGGSNQGIKEPEKLNDNIRCGVIRPRSTVRLDNSVPHRSMTRLNVGGSRAGSVGGL
HKSMTKLNSSQQINLLTNIKPLAAISIPMKQYKIISGGVTVTTSVGNSSPTKSIMKKIYF
HHLRESSSALKDDKESNILASSQNSSAAFSKEVTERHYLKNFTGRANSNTPLQNFSSSTS
STSQLNCGLVSLSQPSTTLNQSNPVVAQRRHNNQISVFEPYPMRDTVQHFCEKHLDKIKA
YMEKVSVKIPPPAKCTIEEKRAKKLAKLHFACQGRGEHCLYKRTFFTMKTRNPKTWIHLM
FLALQARSQSALSSRDSSVSSLKICWDILKCENKTFLTLVTSAFPCAKDQEAILNELRVS
GFQDVFECVRSSAGPMWGCFLCNPPEKAVGFLQDSHPVIEGQLKEKKGKWKIFKRWRTRY
FTLSGAHLSYKVSKDDKDVIPIEVNQIRSVKVSRGARNIPKAFEIFTGDQSLILKPKGGK
NVEEWVQCLSIVVAHSQSKELPVKSHSLPARTLI
Download sequence
Identical sequences E0VK69
vb|PHUM257830-PA|EEB13775.1|conserved 121224.XP_002426513 XP_002426513.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]