SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM259320-PA|EEB13805.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM259320-PA|EEB13805.1|hypothetical
Domain Number 1 Region: 492-556
Classification Level Classification E-value
Superfamily Chromo domain-like 8.25e-26
Family Chromo domain 0.0000308
Further Details:      
 
Domain Number 2 Region: 401-462
Classification Level Classification E-value
Superfamily Chromo domain-like 2.32e-21
Family Chromo domain 0.00026
Further Details:      
 
Domain Number 3 Region: 139-359
Classification Level Classification E-value
Superfamily ARM repeat 0.0000006
Family HEAT repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM259320-PA|EEB13805.1|hypothetical
Sequence length 569
Comment protein Phum_PHUM259320|DS235241.1:1021:4483:1|gene:PHUM259320
Sequence
MNPETFYENLHVLKATKNENFYENLLAIVNFNLVEKFEHGSDRPCTKDDFNKSIENRDKQ
ISFAYLIFTDLIRSGFFSDENFCLELELLVALFILCGENSEIKPWNTENTVKTCKLLLSE
VLNLYKCSDVTDLVKKKYGHKLFKKILQTIRPKLLPDSWKFFPSTIVCYKWILHYIIQPE
LSYHLNSVLPTALLLVDDYINDNKIIGITCLSHIIKNLTLAELQYHNHGDVIYNALLPLI
RLRDSEIIAKVLPTLVLITSKMEFCLDNKNLTDWSKFDCIYEIYLENMELESVLNMRNCY
IQNLALLLKATTNELLRWCKRLLRIFNEYIEIAVKHDDDFVISCSLKNIEIFIEQTVAAK
HLYGRKLSFILIKTLLNSTKGSSDEQKKNKENKDVTSGDGEEPEEEFSVEKVLDRRVRNG
KVEYLLKWKGYSNDDNTWEPEENLDCPDLISEYEEIRKKKEIVKKNDHKRKSTHEDKKNV
PTKRKHSEEDGKPRGFDRGIEPEKIIGATDSSGELMFLMKWKGIDEADLVPARQANVKCP
QIVIAFYEERLTWHTSAHDEEDDTAGDVA
Download sequence
Identical sequences E0VK99
vb|PHUM259320-PA|EEB13805.1|hypothetical 121224.XP_002426543 XP_002426543.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]