SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM259640-PA|EEB13817.1|tyrosine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM259640-PA|EEB13817.1|tyrosine-protein
Domain Number 1 Region: 578-841
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-81
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 13-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.41e-24
Family FCH domain 0.035
Further Details:      
 
Domain Number 3 Region: 481-606
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-22
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM259640-PA|EEB13817.1|tyrosine-protein
Sequence length 850
Comment kinase transforming protein FPS, putative|DS235241.1:55294:61439:1|gene:PHUM259640
Sequence
MVLSPVIQTQTVHETLLGRQDFELRLLETVKKSLQSKIRCDKEYSSTLLGVVAQGQKIEG
SDDLLGSVITQSWKTLLEGFEFLAKLVKQNAEAIEINVLDKINQLYLDKKKIKKSYIDEY
GKISLQFSKISDDVGKKKLEYQKNLEIFKSMRSRLEEFYVKGGRGSKKIEEIREKYQKTC
RKLHLAHNEYVLLLAEATEFEKDFRILLFPGLLEYHQCLQDNLNHEWKKVFEDVARNSSL
CTEQLQDLENRVVKIIQDIKPNEEYSVITDKLRTSFSTSSFSFDESLTTDAPGKLLPNQL
VVDNLTNEWLKSKLSEVDGKIKEEQEKMIELGEFILNNGKSHEVAKKRHELIEIRCDERK
LSKQSEMIKVALNELGSDELPSGCDLPIDNSLPINLENEGGGIGKSLEEDIDLDGMKNKT
IRKKRLTGHFNTLMGHIRRKSGPSTPVLGRFSFEGKNDEAKEAEKIRDGFGKVLNNNGKA
LIDEEWFHGVLPREEVVRLLRHEGDFLVRETTRNDECQTVLSVAWGGHKHFIVQTNLEGH
FRFEGPSFPTIQELILYQYQSGLPVTSRSGAILKKPILREVWELNNDDVQLLDKIGRGNF
GDVYKAKLKSTNQEVAVKTCRVALPDENKRKFLQEGRILKQYDHPNIVKLIGICVQKQPI
MIVMELVPGGSLLTFLRNNASTLTQKLLLKMCRDTASGMQYLESRNCIHRDLAARNCLIG
YENMVKISDFGMSREEEEYIVSDGMKQIPIKWTAPEALNFGKYTSLCDVWSYGVLAWEIF
ARGGVPYPGLSNSKAREKIDGGYRMSAPEGTPEEIYRLMLRCWEYKPENRPHFTEIYNIV
NNLCIKLFDE
Download sequence
Identical sequences E0VKB1
vb|PHUM259640-PA|EEB13817.1|tyrosine-protein 121224.XP_002426555 XP_002426555.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]