SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM260570-PA|EEB13841.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM260570-PA|EEB13841.1|hypothetical
Domain Number - Region: 158-197
Classification Level Classification E-value
Superfamily PH domain-like 0.0348
Family Phosphotyrosine-binding domain (PTB) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM260570-PA|EEB13841.1|hypothetical
Sequence length 700
Comment protein Phum_PHUM260570|DS235242.1:9940:12123:-1|gene:PHUM260570
Sequence
MYSFEVTEIGRESVKSVNASMLATLIKDLDKLEFSRKKNKKNGDDEGFESDGNEDDSLSG
DLSNEDAQSTTSSCCMVEDHVFKSLKSEFISRNLFNNNNNKDPTSLVSIIGSIDSANSSG
SSDTDEIEFHSLTPSPVVTQTKKSLQKKFDTIFKSPGDFDKKSTKMEEYPISDVIFCHTE
PKYPNVIAWVIKKNTTSDPGFKSGVGDNFTKIDNCLEVIVVKCKNGDNLKELCSNYLEYS
KRTKLDNYKSIKRKSDAEGKKLINLNPLPPESKDVKVSLSDMKIENSGLIKASELSILNP
KIMTSFKNDIKNSISLNSLIKSDKNLSNKTTIEIKPSSNNNSNVTTASLQSSVTKTQSLV
NISKSWEYETSNSIMKTAGILKEKNYNVGDQFNLVQRTDPNGVTHLEVTKTVEQTKQVPE
KKFANKSKLRKEIEGVIITDVESYCKKEQIRQRYGEKDKKIYDFPPPIRPERKKLGRKKN
QAPSPPTNHHHHHHNLDQKITTGNVKNNFYLSPTTTTTTSPQPPQPQNVVVVVGDNRIKK
EPNLGKSPLIDVKTWQNQNSIRDANNKTGSRGRQQTTTTKHDEKYVDKKRSTSAAGRPTK
KTLMPYRYIYISNDYRESAESIKRCGLQSKIREVGGNLHNSLQNFRRRNSFDDIMSYNNN
NNNNNCNKISNLKSVIKKNKKYCEPKKVTFSAFATVQVVD
Download sequence
Identical sequences E0VKD5
121224.XP_002426579 XP_002426579.1.24195 vb|PHUM260570-PA|EEB13841.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]