SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM261940-PA|EEB13859.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM261940-PA|EEB13859.1|protein
Domain Number 1 Region: 141-427
Classification Level Classification E-value
Superfamily RNI-like 4.63e-28
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily PX domain 1.96e-21
Family PX domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM261940-PA|EEB13859.1|protein
Sequence length 448
Comment phosphatase 1 regulatory subunit, putative|DS235243.1:233282:234699:-1|gene:PHUM261940
Sequence
MACFYKNCDKLKITIPRVEEKNKFTVYEIQIEVDDVKWSVFHRFRDFAQLHDVLVASHSV
AKDLLPPKKVIGNKEPTFIEKRRNGLENYLITVVRFLQKTMPRELAHFLDFQYYDIQFLL
YSLAEKFYMEDEESVLKSHIFTPLELHAISERLKQPCVNFGQIDLKQDFSHVLDYCTRLK
ELKIHGSVNAVKNSNIIPNKLSYEFSSFKSLEKLYLRNVNCDMIVDFGTLRSTLKTIEIH
NSNIVNLSEILLCDQVHRDEIDVNGPNVFKNIINADFSDNNLTSIDKSIQLLPNVESLNF
EGNKIKDLQFLNSLIKLKYLNLSANHFKSTQSLEIKLCKIVFLDMSQNQLTTLREFAKLY
SLETLNVSSNKISDVSEIKHISNLPCLENLILTGNSISFIVDYRLKVLELFGNRVSEICL
DNEKPNQKELDKVAILQAIRLAKEGQRK
Download sequence
Identical sequences E0VKE3
XP_002426597.1.24195 vb|PHUM261940-PA|EEB13859.1|protein 121224.XP_002426597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]