SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM262620-PA|EEB13868.1|Rho-GTPase-activating from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM262620-PA|EEB13868.1|Rho-GTPase-activating
Domain Number 1 Region: 387-567
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 8-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-50
Family BAR domain 0.014
Further Details:      
 
Domain Number 3 Region: 261-360
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM262620-PA|EEB13868.1|Rho-GTPase-activating
Sequence length 586
Comment protein, putative|DS235243.1:393006:418958:-1|gene:PHUM262620
Sequence
MTTAALPPLEFTDCLADSPFFRDNLHIHEKELERTSHQIKRLEKEVKDLITAAKNLSIAQ
RKLSRSLENFSFAGIENTQTDDERVIQESLKEFGALIAKIEDVRERIESSVDDGEKKIIS
GKYTLGDDDVIIKRLIWWRLLYNRYLHKTNKQREREADATLDMEERELCQASLRYVFLLQ
EVEERKKFEFVETLLSFLFSWLTFYHQGHDVYGEFKPYMTELQLKIQKHKNSFQVIYLFI
CFAFDKERRKPPDPTIVKSLFTREGYLFLMEKKAFGTTWTKQYCRYKKDTKEFEMIPFHQ
MTTKTNAAEKIKLASCTRRMSDSIEKRFCFDLISSDKPGVVYTLQALSEADRKLWMDAMD
GKEPTYAIPGNIPKSEERQLDETGINFVKKCIEVIESRGLEEQGLYRIVGVNSKVNKLLS
MVLDRRKADKLNLDDVYEWESKTLTSALKNFLRNLPEPLMTYKLHDSFIEAAKKSSNALR
VSSVHLLVHKLPQPNFQILDLLIKHLSNVASKSDKNLMSVSNLGVCFGPTLLRPEEETVA
AILNIKFCNIVVEIMIENYEKIFKGPPDGKNGNLFNSSQGNVREVS
Download sequence
Identical sequences E0VKF1
vb|PHUM262620-PA|EEB13868.1|Rho-GTPase-activating 121224.XP_002426606 XP_002426606.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]