SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM269380-PA|EEB14004.1|collybistin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM269380-PA|EEB14004.1|collybistin
Domain Number 1 Region: 321-533
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-53
Family DBL homology domain (DH-domain) 0.00000471
Further Details:      
 
Domain Number 2 Region: 519-674
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-27
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM269380-PA|EEB14004.1|collybistin
Sequence length 687
Comment putative|DS235250.1:387405:391885:1|gene:PHUM269380
Sequence
MMETAEEAHIVTNYLNQSRSREAARNLLLHRQYNQLPPEKKKDKIEQSFSKIKKKDFQKR
KKPSSFQFNKNSIENFNIQNTDEKKKNGKHNSNSSDGRKNDLNADSELVHSLKIKNDLHL
KENKNFLPNPGIGIKVLFFDEKNFHFQFLSSSLIFQKEPTKKNHKKVTSNNCADSLKNRK
LRKNRLCRSMSYPFQRGKVPRVYKLNIHRSYSMIYGSQVENTFNYISIRPVIAHFLHESE
ELSDRNNWLTRPIWTQLKVKPYGTDRKNKKTSHLINVKEKGKVEFYSSSQAFEPTFTDNF
FHSDDVEEKTRKLNEIENDASLHFYIRNRTFVIKELIKNERDFVQILTDIAEGYINECKK
RTDLFSKEMINSIFGNLEDLLIFQKKFMINVEENVNPLFPHKSCLGKIFLDHERNFKMYA
LYCVSYPTAIIILQSLYSRDVYTKFFEACRLKRGLNNISLDGYLLTPIQRICKYPLQLAE
LLKWTEPSHPDHNVVKEALQAMKKVATLIDDQRKTMDDLEKLVVWQSKIFDWKEEEEDVI
IKSCQMLYRGEGTRIISKKKNTNVTMFLFDHQLIFCKKKNFFNKNYYTYKGRINLDFSKI
INLPDGPNREVEMLIKNGIKIYVAKENKWEIICYESKVEKNKWIKAFIDERKIVEKMKRE
GLELPVSIKKLAKVAVETKNMYLKSKV
Download sequence
Identical sequences E0VKU8
XP_002426742.1.24195 121224.XP_002426742 vb|PHUM269380-PA|EEB14004.1|collybistin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]