SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM279900-PA|EEB14083.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM279900-PA|EEB14083.1|conserved
Domain Number 1 Region: 66-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.89e-64
Family Extended AAA-ATPase domain 0.000000302
Further Details:      
 
Domain Number 2 Region: 322-497
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.22e-58
Family FtsH protease domain-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM279900-PA|EEB14083.1|conserved
Sequence length 502
Comment hypothetical protein|DS235266.1:64096:65909:1|gene:PHUM279900
Sequence
MAFTDGYMAASRQILEPKPTSKFMKVFTPILTIFFISGFLICLIIIVSGSVFRTQMSKYL
EVNPEEIHVTFRDVKGAEEAKQELKEIVAFLRNPEKFSILGGKLPKGVLLVGPPGTGKTL
LARAVAGEAKVPFFHAAGPEFDEVLVGQGARRVRDLFKAAKEVAPCVIFIDEIDSVGSKR
TNSTLHPYANQTINQLLSEMDGFHQNEGVIVLGATNRRNDLDKALLRPGRFDVEVMVPIP
DYTERKEIIEYYLSKILYKDINLELLARGTVGFTGADLENMVNQAALRAAIEGADSVTMA
YLESAKDKILMGPERKSRMPDSETNLITAYHESGHTIVCYYTKDSKPIHKVTILPRGRSL
GHTAYIPEKEQYLVKKSELLATMDTLMGGRAAEEIIFGPDKITTGASNDLKEATSIATHM
VKEWGMSESVGLRTVEENQRSSEAIDAEISWLLQESYKRAKTIIKNYSRELKLLVEALLK
YETLDADDTQNCLSAHSMFTFN
Download sequence
Identical sequences E0VL27
vb|PHUM279900-PA|EEB14083.1|conserved 121224.XP_002426821 XP_002426821.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]