SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM288580-PA|EEB14251.1|CDC42 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM288580-PA|EEB14251.1|CDC42
Domain Number 1 Region: 312-512
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000342
Further Details:      
 
Domain Number 2 Region: 201-293
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000656
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 3 Region: 87-183
Classification Level Classification E-value
Superfamily PX domain 0.0000000628
Family PX domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM288580-PA|EEB14251.1|CDC42
Sequence length 1603
Comment GTPase-activating protein, putative|DS235271.1:1361266:1367278:1|gene:PHUM288580
Sequence
MGSIRKTRELSDIAPQFDVKGGLCKSYNLDNGSSSSGIKIQHVTELNNVLEEKSRFPKLE
ECAHFHYDHVEIGSLQVVIIDDGSLKSYKNSGEEKWWSLNVQSQNKSWLVKRSYDNFKML
DKQLHQCIYDRKFSELMELPEECIEEQENLHKVLSDYMKRFSSIAGNLINCGPILNWLEL
DNKGHRLLIPNNINYPINTPAVAAAYSVKRYSAQAPDEISFEVGDMISVIDMPPSEESIW
WRGKRGFQVGFFPCECVAVIGDKIPKNIKFSSKISQPTKPVLRKHGKLISFFRSFILSRP
SRRRLKQSGILKERVFGCDLGEHLLNSGHEIPMVLKCCVEFIEYHGLIDGIYRLSGVTSN
IQKLRNTFDEDRVPALYEDQAILQDVHSVASLLKMYFRELPNPLCTYQLYYQFVGAIQTQ
DKENARLLKIRDVVQKLPPPHYRTLKYLTKHLARVSEKGAETGMTSRNIAIVWAPNLLRC
KELEVGGVAALQGVGVQAVVTEFLICYADLIFSDQLPNFNVSTEGSVKKSRPKSLAISTP
TKLLSLEEARTRALLQTSNKEESNYIEVGGGPSCLPAKYHTVIELPGYTRKRLGSKRSPI
GWKFLFGKTGRSSNPSSKETSSKTSSDVFDVVLPVLQNRLLLRPAKSAESLNSSQQSITL
DVRSSLSVKIENPNSSIVNSPSVKNCDGKNGHNRSVSHESYFDHYQDTKKNLTSDISEIQ
VNFDLEESEMRIFSEDETLLSAGSDSLTSNSSPRLINSQKSGKSTTGNSIKRSSCPKLNT
TENFLNADPSPKKQKTNEENCFKSKLEEQLSSSMGDIQFIDSVSPDQGLVPCEMGPIQSP
SSIASISQMSSLLLVPSSPILPHIPHLNFPFSVTSDTSNSHNDFKTNDGPNDNLLTNSST
NDSIEQCSSHETNNFNKLVDESSGRCLNGSNVIEISASSSGGSIGEITPDSSVGLPYTPL
VDTRETNDFPDVKQPPSHDSTNSTTKICLPKSSENDDDSLITKRNSVSNVFAKNECEVKL
LPCRKTATELNVVVDKSDDGKKLTSSDKSLEKSSIIMSSSSSDFSINDKSIVLETSFETK
PLPNSNRNNPDSIKYECISTESSCDSLINVNNKNNEENTSLLGLLCDLDDIALKNLTDNK
MDSSKDDLRMLPSNDEFEKDSKGEIVGDDKRLDDEKSVPENYLDSERNLVSLRNYPETKR
HSGNLLETDLDALDVLEMANFPSRSSFDDIKENSTNVFVPQKSSSSGNVQQLLSKFEIKP
SSKTVSNDVENTVTKKEIKSMECSKPDNGRHELFERPKTLERMCAKRKTGKDYVEMEKVS
LGKSKSGSQINEKKTDGEKFEKFIAGGGGGGGDFDLSDPQRRERIEKYKEKRRNYLREKY
RSDSFKNDKSGENLSTTGNNNKLKFSFKKEREITVGENFDVTDRNDESPPGRGCSNDVIN
SDKKNKFTGSKMSKVSDSVSKDLLRRSLPSEISSERSRFELTSLSNTFKQYSTRKGSGIQ
RLHSEPKNTRSQQDFDDGKKIHQTLGQASPDGNISHCKSASTKIKSDILKTLVNTSDVEN
QNVKKINSAENDKSPTTVCIKDLRAQFEEQSVANTAKQYLSSV
Download sequence
Identical sequences E0VLJ5
121224.XP_002426989 XP_002426989.1.24195 vb|PHUM288580-PA|EEB14251.1|CDC42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]