SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM293220-PA|EEB14332.1|Rho-GTPase-activating from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM293220-PA|EEB14332.1|Rho-GTPase-activating
Domain Number 1 Region: 1370-1567
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 26-41,74-95,126-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000663
Family G proteins 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM293220-PA|EEB14332.1|Rho-GTPase-activating
Domain Number - Region: 428-489
Classification Level Classification E-value
Superfamily FF domain 0.00225
Family FF domain 0.01
Further Details:      
 
Domain Number - Region: 266-332
Classification Level Classification E-value
Superfamily FF domain 0.0105
Family FF domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM293220-PA|EEB14332.1|Rho-GTPase-activating
Sequence length 1575
Comment protein, putative|DS235281.1:79881:84608:-1|gene:PHUM293220
Sequence
MARKGETSRVFNISVVGLSGTEKEKGQVGVGKSCLCNRFMRSLADDYSSDHISVLSQSDF
SGRVVNNDHFLYWGEVTKTSEEGVDFTFQVIEQTEFIDDASFQPFKGGKMEPYVKRCSAI
KLSSAEKLMYICKNQLGIEKEYEQKVLPDGKINIDGFLCVFDVSNVPGRLIEKQVEIVTA
ILNNLIKTKKPIVLVTTKNDEAFEGYVKEAERLLTKKEYKNGIFMVETSAHENVNVDLAF
ILVAQLIDRTKGRCKIVSFAEADSRKKELGESVTQTFQMLIRSQVTDFTVMWTHTLKKLS
QHPEFSHYVALFGVDSAQRLFRRHIKKLKEEHVKKRIQGYMEMLPDILQEMVPDLSSLRD
CDWATVQRHIQEHPDFHQYFFECPEDIPWTECDLEEIGHNQIPFDVLDSNEAETVYKNHV
NALQQDQKRLEWKKQFKQLLEDTGYVTPGKLLSEVRVLFMGRECFETLSESDCQLIYDQH
QKEIIEKAKHNFQELLLEHADVFYHFKSIAPAGTITQEYIKEITDALQEDSRYKALDRLD
QDRKLMLFQHLGFVHCPIREHCPAFPNCMDALIERILGAKAHRPSSWNHSSQWLLSSDSN
RLNLVILGINGLAEELVTEIRTMCEGDEYELSCQLYSLDYRIINGDVSLPQNSFKTNEFL
PHGCFCVYSNADSFEYIRESLEKTLLSNLEQEDRLPFQGLPIVILFSADQSVDEKEGIRL
REEGQNLADSLQCPFIDVSLEENSLDRRQFNSLIVSDALKQLVQSIRHRSGFINIYQSVI
DSSEPDIRVIMCMFCGDPYNVENVLSPLLNHQCCFLSGDKSIILETFLGDSKHKVEVIIS
SFHGANAFCEELVHGFILVYSTKRKASLATLNAFSMNIPNLPIQILAVTETGGANAFFSN
DLSHLLITEGNAIADRLQAHFMTSSSSTQQKTAFYTPFFKEVWENKPEIEQAFHMEEPSN
IQDSGDDTLERRHPLPPPRLESYLIKSGSNDGSESEIYERFPTDGDDMNDSLSPTYPEDG
LLSLSEDSDIYTHVDIYGNGGENHLVKNSDLKPKLNQVWVDDVYLQQNRRDRNEDLWLSN
YSQHAFTTGRRHSNKLKNKDRSHTLKQPGKINLKDFANVTENIARIHLGGDKMSNRSMRG
HAPLVPAENIDLEYSQIKDAIHSHYGPYDGEFSYGFVPDGLSLKSKFRRRRKKGRPSNSE
TASDSSEESDPDLSGSSRSRTKLNKKSLRSKKRIGKVPVGQPVRIPIPPELRTPHIMQQH
QFNSGLSVDNDIMGNPSYVIHDDESSLDVSSPRDINSPLFGGLSKGLKENDKTARRKEKQ
KAKEDEKLRLKEEKLKKIAEKEREREKKKLKSKPLKISGPNSLDCFTHTEDNLLPLFLEK
CVKFIEEEGLDSEGIYRVPGNRAHVELLFQKFEENPNVNIQDLDIPVNAVATALKDFFSK
KRPPLLSCELMSELEDISGARGMMMIEQANLNVDIKADRSCRLLALRSLLKKAPKESFEI
LKFIFQHFVKVAENCKLNSMDSKNLAICWWPTLLPIEFSDMGCFEQMRPHLEDIVQTMID
QYPFLFCGKEAFVMV
Download sequence
Identical sequences E0VLS6
XP_002427070.1.24195 121224.XP_002427070 vb|PHUM293220-PA|EEB14332.1|Rho-GTPase-activating

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]