SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM299490-PA|EEB14423.1|RAC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM299490-PA|EEB14423.1|RAC
Domain Number 1 Region: 177-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-99
Family Protein kinases, catalytic subunit 0.000000000579
Further Details:      
 
Domain Number 2 Region: 18-124
Classification Level Classification E-value
Superfamily PH domain-like 2.23e-24
Family Pleckstrin-homology domain (PH domain) 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM299490-PA|EEB14423.1|RAC
Sequence length 528
Comment protein kinase DRAC-PK85, putative|DS235286.1:96502:98871:-1|gene:PHUM299490
Sequence
MAESSSTLPRAGSAADLPPANIIKEGWLFKRGEHIKNWRSRYFILFDDGSLVGFKNKPES
VGAYSDPLNNFTVKGCQIMSVDRPKPYTFIIRGLQMTTVIERTFHVETEKEREDWVAAIR
LVAARLAGIEDVDVEMRSNSASGNGSIDVGTIDDLSAKFSVQGTSHTKSSGKKKVTLENF
EFLKVLGKGTFGKVILCREKATGHLYAIKILKKEVIIEKDEVAHTLTENRVLRTTNHPFL
ISLKYAFQTADRLCFVMEYVNGGELFFHLSRERLFGEERTRFYGAEIISALGYLHEQGII
YRDLKLENLLLDNTGHIKIADFGLCKEDITYGRTTKTFCGTPEYLAPEVLEDNDYGRAVD
WWGVGVVMYEMMCGRLPFFNKDHDKLFALILMEDVKFPRTISAEARSVLAGLLIKNPQKR
LGGGVDDAREIMNHPFFASVNWVDLVQKKITPPFKPQVTDDTDTRYFDSEFTGESVELTP
PENPGPLNTIAEELDQNQPYFPQFSYSDLSSTLSASSSSLAQSAGAMH
Download sequence
Identical sequences E0VM17
vb|PHUM299490-PA|EEB14423.1|RAC 121224.XP_002427161 XP_002427161.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]