SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM302720-PA|EEB14478.1|DNA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM302720-PA|EEB14478.1|DNA
Domain Number 1 Region: 16-94,141-306
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-61
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 345-644
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.92e-40
Family Extended AAA-ATPase domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM302720-PA|EEB14478.1|DNA
Sequence length 723
Comment replication licensing factor mcm7, putative|DS235291.1:21560:25182:1|gene:PHUM302720
Sequence
MSKKVTNTYDTDKKTFKSFLTEFMELDGNKQKNYKYVQQMTKLAQREQVAMYIELDDIES
YNSELCERVLKNTKRYISILYETVQELLPSYKMHDVPAKDSLDVYIEHRLMMDEKTKGQE
GVTTSHNPYNKFPPELMRRFEIYLKNSSTSKSLPIRQIKASHVGSLITVRGIVTRCSEVK
PLVCVATYTCDVCGAETYQPVNSLTFMPIATCPSDDCRINKSGGRLHLQTRGSKFIKFQE
ICVQEPSDVVPVGHIPRSISVFCRGENTRLVLPGDHVAITGIFLPLLRQGFSQLIQGLVS
EHFIDAQVTCGGESVDNLDADFTESEIQEIQSGNLYNKLASSLAPEIYGHEDVKKALLLL
LVGGVDRRPEGLKIRGNTHMCLMGDPGVAKSQLLTYIDRIAVRSQYTTGKGSSGVGLTAA
VMKDSITGELMLEGGALVLADEGICCIDEFDKMTEHDRTAIHEVMEQQTISIAKAGIITS
LNARVSILAAANPAYGRYNPKRTVEQNIQLPAALLSRFDLLWLIRDQPDRDNDLRLAQHI
TYVHRHNSQPKTKVDTVDPLFFKKYIAKCKTLNPTIPESLSDYIVQNYVEMRKRARNDKD
QTFTSPRNLLAVLRLSTALARLRNSNEVDKGDVQEAIRLMEMSKQSIMAVDDGLSKPANP
IDHIYEIIRDFRNEDLSSVKMADIVSRCVAKGFHPDQINRCVEEYEELNVWSINQARTTL
TFL
Download sequence
Identical sequences E0VM72
vb|PHUM302720-PA|EEB14478.1|DNA 121224.XP_002427216 XP_002427216.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]