SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM303870-PA|EEB14485.1|Ras from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM303870-PA|EEB14485.1|Ras
Domain Number 1 Region: 310-640
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-77
Family p120GAP domain-like 0.0000475
Further Details:      
 
Domain Number 2 Region: 597-734
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-42
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 13-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-22
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Domain Number 4 Region: 145-320
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-20
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM303870-PA|EEB14485.1|Ras
Sequence length 950
Comment GTPase-activating protein, putative|DS235294.1:59835:64853:1|gene:PHUM303870
Sequence
MADQKREVRVEERLKIKIGEAKNLPSRHQGGPGGYRDVFCALTLDQEEIFRTTTVERTLN
PFFGEEFQFEIPRRFRYLSVYVYDRDKNEKVIGKVAIKREDLTSYNNKDHWFQLKNVDCD
SEVQGKCQVGVKLESSLDANGDDKVVVRLLECSDLTLKGGSCDPFATVTMVYSNGKQDLK
RTKVKKKTNSPKFDETFTFEVCQNHDRDTYQVHNTERDVEFSEVLVTLWHDSPGMSDNLF
LGEVRIPVRVHVIQQYGVNNAWYYLQPRSNKSRSSSKSQSVNSTLKSTNNLNELGSIRLK
MNYEADHVFPSQFYEPLRKILLESSNMKPVTSSAAYILGEIVTSKMEAAQPLVRIMTHHG
QIVSIIKALAKWEISKVTDANTIFRGNTLVSKMMDEVMRLAGSHYLRSTLKPSLEVILSE
KKNCEIDPTRVKDTGQIETNLANLKEYVEKVFKSITSSSLSCPTLMCELFQVLKELAIER
FPNNNEVRYSVISGFIFLRFFAPAILGPKLFDLTSSPIDQQTNRTLTLISKTMQSLGNLV
SCKYKTSGLEQHKEKYMSRLLESFQNPPHIEAVRQFLEIISASSRPNGQSCTTFAPVVLK
EGIMVKRAQGRKRFGRKNFKQRYFRLTTQDLSYSKAKGKEPLCCIPLSQILAVERLNEDS
FKMKNMFQIIQSERRMLYVQANNCVEEKEWIDILTKICQTNTNRLERFHPSAFINGKWLC
CNKFQESAQGCQEVTRRERLEMTLDPDRELQRIHSIIISQIKRLETLISGCYYYNHDSNA
ATQFKVEDVNSYLHTLNELKNISLNLEQEHRIYQRQLARETKYGSKQAPIGDNNYLLLAT
RSPFDPTVTLRNYDSWKIGSTSSMPAMMPTRSCTSFRSARPGADGESNVYTILKYDYSPA
CGQCDTSTNVQLTTGSTVEDSSSSGKRLYEKKDIVHQGKKPSFPERVCTS
Download sequence
Identical sequences E0VM79
XP_002427223.1.24195 vb|PHUM303870-PA|EEB14485.1|Ras 121224.XP_002427223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]