SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM305940-PA|EEB14502.1|tyrosine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM305940-PA|EEB14502.1|tyrosine-protein
Domain Number 1 Region: 241-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-71
Family Protein kinases, catalytic subunit 0.0000000994
Further Details:      
 
Domain Number 2 Region: 135-282
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-38
Family SH2 domain 0.0000251
Further Details:      
 
Domain Number 3 Region: 64-145
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-21
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM305940-PA|EEB14502.1|tyrosine-protein
Sequence length 493
Comment kinase Src64B, putative|DS235303.1:50936:52929:1|gene:PHUM305940
Sequence
MTQKDMKLNQSIVYQHAYKVPDGEFIVHTVNGGGGGGDPRYTPDPNRPPVMQVKRQGVDI
IRTPTTPFHPTLTHRRIVIAKYPYNAREAADVSFLKGDRMEILDDSEPDWWRVKHLRTGE
EGFIPWNFVAEEKSIESEDWFFGKISRKEAERLLLSVENPRGTFLVRNSEHNPNGFSLSV
KDWEEARGYHPKHYKIKPLDNGGFYIATNQTFPSLQNLVMAYSKNALGLCHVLSRPCPKP
KPQIWDLSINMRDQWEIDRSEIQLIKKLGQGNFGEVWYGKWRNDIEVAVKTLRQGTMSTA
AFLQEASIMKKFRHDRLVALYAVCSKEEPIYIVQEYMNKGSLLEFLRNGEGKDLGFGDLI
YIAAQIASGMEYLEQKQLIHRDLAARNVLIGDNNVAKICDFGLARIIEDDEYCPKQGSRF
PVKWTAPEAIVYGRFSIKSDVWSYGILLMELFTYGQIPYPAMHGREVIEQVERGYRMPKP
AMLGCHTRKATHI
Download sequence
Identical sequences E0VM96
vb|PHUM305940-PA|EEB14502.1|tyrosine-protein 121224.XP_002427240 XP_002427240.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]