SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM307830-PA|EEB14533.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM307830-PA|EEB14533.1|conserved
Domain Number 1 Region: 182-488
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.14e-57
Family Myotubularin-like phosphatases 0.0001
Further Details:      
 
Domain Number 2 Region: 18-163
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-17
Family GRAM domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM307830-PA|EEB14533.1|conserved
Sequence length 657
Comment hypothetical protein|DS235306.1:148345:151818:-1|gene:PHUM307830
Sequence
MEDCNKNAEDNTFSKFKPKLLDGEIVITEGNRVLYFPNAAERSKGLSGNLYVTNFRFMFE
AYESEDCSKEISVHQVNNLLGNHGACLTNVQSVYQLCGDKKKKLFQDSQLSDKIKGLQIV
CKNLKVFTFNFDQSPIIQGKNIAKTLLHHAFPGRHQLLFAYDYSDEKTENFYKNTKVVFF
SKKSEWEDELIRTCSASASKWRISCQNHKFQISTSLPQWLVVPHSLLDYDFVTASQSFRC
NRPPIWTWSNPNGAALIRTANLIPSLTDRTQENRMLENIRKCHPQLKGPCIKDLDKDLPS
VIELHQSFIKLRDLCILDSHRQFKLQDSHMYSSLENTKWLHHVSSCLKLSVEAAREIQKG
TTVVLQESDGRDTSAIVSSLVQLLLDPHSRSIVGFQSLIQKEWIALGHPFCKSQNERLQL
RSVWNWNIQFSESDVELFFNPLYKFCQISNYPSLKESYDHQKRDIVIFPEFSVPYLGLWM
QCYFRWLSLLSIRSGGRPQVDIVHRHLLKRIQSLIVDFQELNSKKIDNCFLNNISELRSS
MSNNNNSNNNNNIKDDNKNSDYVDNNSKPNKTSNSVSKKLEKKESNGGGKSYNNSNDRIG
EEVEYENLSDAKLLFIKRNAIDNFFPFTINTSNSFSGFVTDTHLKEIDSSSIINVSD
Download sequence
Identical sequences E0VMC7
XP_002427271.1.24195 vb|PHUM307830-PA|EEB14533.1|conserved 121224.XP_002427271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]