SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM308920-PA|EEB14573.1|blooms from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM308920-PA|EEB14573.1|blooms
Domain Number 1 Region: 448-742
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.37e-55
Family Tandem AAA-ATPase domain 0.00014
Further Details:      
 
Domain Number 2 Region: 811-928
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000898
Family RecQ helicase DNA-binding domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 956-1032
Classification Level Classification E-value
Superfamily HRDC-like 0.00000000000072
Family HRDC domain from helicases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM308920-PA|EEB14573.1|blooms
Sequence length 1152
Comment syndrome DNA helicase, putative|DS235307.1:231010:234680:-1|gene:PHUM308920
Sequence
MQHFILKILIYRSPSDKSLSSDQYHIDEANFWDDDDSNDIFEMPKKRSKEKSPVLMTSQV
METKMLNNVESTILNSSSESQSKIPDKDECCFDLDFESDFSLEIGCDKNDTLENCKSPTF
DLPVNPSKLSSNSFVESPKFEKSKNLNLNFSNVELTESNNDSLNLNSIQKDKLKPIGINK
ETGMWLSKMIENEAFQNISMDTSEETLQNNLLFLNKLYIEILEKIMSAFESLPLEMLKWF
PDFDADICVTLRTTKRRVKAIIIKTENLLKKKSAFESSTDYNLSKSSLQPTNSLDVSNFS
LNSTNISENFPVGNENNSRSFFSENDYNQEIHNVSAHNSTSTQLGVIDYTDMLYKSPDKT
AAIENASKNSSASQSNMKNDSAQFNGLTYPHSQDLIKMFHLKFGLKSFRTNQLQVMNAAL
LGHDCFVLMPTGGGKSLCYQLPAIVSQGVTVVISPLRSLILDQVTKLVTLDIKACHLSGD
VKESEVVDIYRKLNMPEPEIKLLYVTPEKVGASTSLRNIFSRLYNRNMLARFVIDEAHCV
SQWGHDFRPDYKKLRELRENYPNVNIMALTATATPRVRIDILHQLKVKSPKWFLSSFNRS
NLCYAVKEKKGKSTLKDIAALIQQEFSRDTGIIYCFSRKECEDVARDLKVHGIGAIPYHA
GLNDTERTKAQNLWMNGKVKVVCATIAFGMGIDKLDVRYVFHYSLPKSIEGYYQESGRAG
RDGEKATCILYYSYRDKHRMLKLINMDQSMSNMAAKKVHIDNLYRVVAFAENVTDCRRSL
QLNYFGEKFDRKVCIENRETACDNCLQKGFYETVDVTAESKAIVSAIKEVCGPDHQKHSN
YTMLHFVDIFKGTGMKKVESEGHQNLPLCGMGKSWQRLDAERLIRKLIMEEFLKERIMVK
DEGMTCAYLKCGRRGDELLKGNVKIMFDIKKSKKSTPGASTSKTTKTSVDPAILEIQEKC
YTELMDVIRGIASSLNCNPNAIMNVQALRSMSYNLPETPEEMFLINHVTTANFEKYGNIL
LEITKKYAEEKKAITSVPEVNFPDEDFFTEDEPWSTEILNDNNSHEDTEVTFCGKEKGNR
KRKGTNFRKWSNTKKWKGSTNNSSKGTTKSKSKGKNDFKVASDGSGVTTFSGGGAFSKLM
ELPTSKDRVFNC
Download sequence
Identical sequences E0VMG7
vb|PHUM308920-PA|EEB14573.1|blooms 121224.XP_002427311 XP_002427311.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]