SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM318750-PA|EEB14694.1|Exosome from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM318750-PA|EEB14694.1|Exosome
Domain Number 1 Region: 171-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.33e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000164
Further Details:      
 
Domain Number 2 Region: 77-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.32e-24
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 
Domain Number 3 Region: 26-77
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000968
Family ECR1 N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM318750-PA|EEB14694.1|Exosome
Sequence length 296
Comment complex exonuclease RRP4, putative|DS235324.1:100131:101398:-1|gene:PHUM318750
Sequence
MSENVFIRLGALRINPIIDNNNDTSNIYTPGETITCQTGFMRGHGTYVDDDNNALKASVA
GSVEQVNKLISMRPLKSRYFGEIGDVIVGRITEVQQKRWKVDTNSRLDSILSLSSVNLPG
GELRRRSVEDEQMMRKYLQEGDLISAEIQNILSDGTLQLYTRSLKYGKLSQGILLKVFPS
LVRRSKTHFHSLPCGANIILGNNGFIWITPAALEDKKGGFTQDLKYKVSKTDRIVLSRLR
NCILALANSKMPLYDTSVMYAYEESQKYTVSELLAPEPMLDVAVLTTLRLQMIEDE
Download sequence
Identical sequences E0VMT8
vb|PHUM318750-PA|EEB14694.1|Exosome XP_002427432.1.24195 121224.XP_002427432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]