SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM321600-PA|EEB14740.1|Rho/RAC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM321600-PA|EEB14740.1|Rho/RAC
Domain Number 1 Region: 1344-1549
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-44
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Weak hits

Sequence:  vb|PHUM321600-PA|EEB14740.1|Rho/RAC
Domain Number - Region: 1655-1722
Classification Level Classification E-value
Superfamily PH domain-like 0.0126
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM321600-PA|EEB14740.1|Rho/RAC
Sequence length 1752
Comment guanine nucleotide exchange factor, putative|DS235328.1:58349:66833:-1|gene:PHUM321600
Sequence
MEVNQNRSRKNGKEKQRTIGKSSGKITGSKSSSGIESSNFMVHPDYLQKYGTLSNGVLTK
SIKYAETWLYGTVGVRGAPTPRPSLFIYPGVVPPPSRGLNDNYQSSSNGVYFSDPLKSVS
PVRYRGFSQPSFPNSLDKSRTGDKNDFKIYEFSNGGSSSSSSSSGNNGVLEPVTYAGKKI
KTGGHTISKGSCLKDSVSVRGKKTSSSILGVSDPYNVMRKNRLGSSVDNAESVTLGTYKL
SQSKRPNSIESYPLLQKRESPIETHKSKSSGKEMKYWRNEKEDRTKPEEEVVGRRKSILE
CEVDVYELNKSESKDYSNDSSDEFGINASEIDSSKLTIMRPKLNKTEFIRVSSKKTESKE
FSNENSNKADIVCNGQRFQISKREMRESLNDSDDSGVVAIDKKTGDDAALSPQRPPRRQK
EKPIILKETNLKHTKSRSKSSPNLSIKSILKKPPGNGDDSSIFEGSIIDHNDSPPIQLES
DNNLWKNSMPQLNLINNNNNNSSSSNNNNNSNNNNKNQSQNTLKKKKQVQFKVNNSFENL
NDNNNHSVSGLRRSYSDRRSTPPTINSKNDDNNNSTTTSRSSSSSVQFTDTMALRTRGTR
SDTRGIFTDKSNANQKNIKFEKIVKSKNPGETMVSSNGGGGGGGGEVKSKQKLSGNLITY
EEFSKLIDNSESDRQKSSPSKTTNGNSKVRLKPNAVGVKTKAPAPSPPSRKIPMKKVDKN
SGTISVKVSVKESCHDSPNANVDANKKETRESVESEKSCFETNTTEEKNEKTTLKLNSNL
IKNTESMGKNVESKKPSITIHPKNVINEIEKEPKRKTSVIISNFHPLDSNKVTINVTTEP
CDKEISSSTCTIIETGSNSTVIPVLSTDNKTTLIVGDTCSTILKMNDDETKTTTTTTTTT
APDKFLNNSNKKQLEMLDPVEAVRMNLIPHVCGKTDRDVSNNNNDNNDKQINEQTSNNQK
DLKQTLKLFVDSQECEKTQELSKSSCQDERNVRNGVVAKSKDSSATTSRNNSLEKNSSAN
TSRNNSFKNNQNKKLKSNNESENNVISPPVVTKSKIYITETEDTMEQEKNKLECEYEVQN
DIKENKKKENDNDDDDDDGDACECDHDDDDEENIYETIKEEPIYDKIGSNLDDEAFPSRL
PPLAPFPVFDSAAETPQSQSTAKSIFEGASKYDILSYLVDAKERVQGDSYFNGSTISGDD
SVDCKRLTYDKNDKGYSDRDNNISPDLSEFGKISYAKFISSETDSEMDLSINRYSQISNS
SDDNVNSVLGTPEKMPPLKFHKKSSAEVERNDSGVGSEASHTSRSKWQTYSSIKEDPRNL
CDDCDQIVEAKVTESGAMYIPLVCRKCAKKRSERKEIIQEIVETEEKYGRDLKIILEEFY
TPMLVAGLLTPEQLSAIFLNTEELLENSKILIERLRDTLEIAMEQGDEDFLTVNVGKLFL
EAGPMLHAFERYCIRQGGAAMLLTNLEKEKELLRIFLRVSQMENTVLRRMNLNSFLMVPV
QRVTKYPLLLARLYKVTPVQQENRETLKEAQHKIELHLEHMNSEAKDVSATKVWRRFSTA
TISGRKVATESEIMNIKLRKMAVDVLEWNHEEVRFVLEGKLLYTQPNDNNWKRGKTIKLA
PVFVLLVTLGKPNSKYKMDPTDEDLIFPVKTGIREATLLLVKEKCNRYTLIREPLYLDKI
IVCCETDIDESFEVQELVTKDSFIFKAEDCERTKEWYKQLQYHAQILGMWRKRRNALANI
MINGMMARAQTS
Download sequence
Identical sequences E0VMY4
XP_002427478.1.24195 vb|PHUM321600-PA|EEB14740.1|Rho/RAC 121224.XP_002427478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]