SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM322080-PA|EEB14749.1|Merlin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM322080-PA|EEB14749.1|Merlin
Domain Number 1 Region: 99-207
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-36
Family Second domain of FERM 0.00000412
Further Details:      
 
Domain Number 2 Region: 208-343
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Third domain of FERM 0.00000653
Further Details:      
 
Domain Number 3 Region: 528-610
Classification Level Classification E-value
Superfamily Moesin tail domain 4.05e-28
Family Moesin tail domain 0.00059
Further Details:      
 
Domain Number 4 Region: 10-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-22
Family First domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM322080-PA|EEB14749.1|Merlin
Sequence length 610
Comment putative|DS235331.1:99204:102390:-1|gene:PHUM322080
Sequence
MPPFRRKKSGKSFPVKVCTLDAELEFNLEWKATGRELFDLVCLTIGLRETWYFGLQYEDT
KGFISWLKLDKKVQDQNIAQSGAAQTFMLLAKFYAEDVADELVQEVTQHLFFLQVKQAIL
SMDIYCPPEASVLLASYAVQAKYGDYDESTYKPEMLSSEVLLPQRVIGQYQMTPEMWEDR
IKIWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPITNKRQSELWLGVTALGLNVYERE
NKLAPTITFTWAEIRDISFENKKFILKTVDKLSPNFVFFSKKVRMNKLVRNHDLFMRRRK
PDSMELQQMKAQAKEEKQRRQIERNKLAREKQLREAAERDRAEMEQRLLHYQEEIKLANE
ALRRSEETAELLAEKSKVAEEEAILLSQKASEAEQEITRIRLSAMKTEEEKVLLERKTRE
AEFLTARLVEESERRAAEAERLKDHLLRARLAEKQAKEKLLEFLSINAFHNLTNSVRKFL
FKDIYIYRTVSSMFTNSTVVCVDGHDDIDPLRRNVPQDLSQYDALCHHDVQQLSLEIEKE
RVEYLEKSKQVQEQLRDLRSEIEELKVGEKTTELDNLHDEQVRLGENKYSTLRKVKSGST
KARVAFFEEL
Download sequence
Identical sequences E0VMZ3
121224.XP_002427487 vb|PHUM322080-PA|EEB14749.1|Merlin XP_002427487.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]