SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM322100-PA|EEB14751.1|Ran-specific from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM322100-PA|EEB14751.1|Ran-specific
Domain Number 1 Region: 26-164
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-42
Family Ran-binding domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM322100-PA|EEB14751.1|Ran-specific
Sequence length 232
Comment GTPase-activating protein, putative|DS235331.1:106349:108604:1|gene:PHUM322100
Sequence
MSDTEKESTNEKVKNSDNDTSTDGEHDPHYDPIISLPEVVVSTLEEDETEMLCLRAKLYR
YDATETPPEWKERGTGNVKILHHKINDTVRIVMRRDKTLKLCANHFIMPHMNLQPSISCD
RAWVYSAKDYSDATMKSELLAIKFSNKENAEKWKSAFDSAKKIVAKNDYSKEETPVEEKL
LTKVPPKLSDTFEEESKNSLPDKKEEKEIIDSGKIKNVEVSEKLSSLTLQCS
Download sequence
Identical sequences E0VMZ5
XP_002427489.1.24195 121224.XP_002427489 vb|PHUM322100-PA|EEB14751.1|Ran-specific

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]