SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM323600-PA|EEB14761.1|Negative from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM323600-PA|EEB14761.1|Negative
Domain Number 1 Region: 13-135
Classification Level Classification E-value
Superfamily Histone-fold 3.07e-35
Family TBP-associated factors, TAFs 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM323600-PA|EEB14761.1|Negative
Sequence length 163
Comment cofactor 2 beta, putative|DS235331.1:341546:342228:-1|gene:PHUM323600
Sequence
MASSSAIPPLDDDELTLPRASINKMIKEILPNIRVANESRELILNCCTEFIHLLSSEAND
ICNSQQKKTINSEHVLLGKLGFGDYIPDADAVLQDCKAVAAQRKRQSTRLENLGIPEEEL
LRQQQELFARAREEQAAVEQQQWQHIQNSSQAPSLDNEDEDYC
Download sequence
Identical sequences E0VN05
vb|PHUM323600-PA|EEB14761.1|Negative XP_002427499.1.24195 121224.XP_002427499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]