SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM332570-PA|EEB14860.1|Adapter from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM332570-PA|EEB14860.1|Adapter
Domain Number 1 Region: 10-107,136-162
Classification Level Classification E-value
Superfamily SH2 domain 6.15e-27
Family SH2 domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 104-194
Classification Level Classification E-value
Superfamily SH3-domain 5.33e-18
Family SH3-domain 0.00027
Further Details:      
 
Domain Number 3 Region: 195-257
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000617
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM332570-PA|EEB14860.1|Adapter
Sequence length 263
Comment molecule Crk, putative|DS235335.1:420377:421400:1|gene:PHUM332570
Sequence
MASTFDPFDRTSWYFGQMSRQDATDLLMSEKEGGVFLIRDSISISGDYVLCVREDSKVSH
YIINKIQQGEQTIYRIGDQKFPDLPSLLTFYKLHYLDTTPLIKPAPKRVEKVIAKYDFDG
NDPDDLPFKKGEVLLIVSKDEDQWWTARNSLGKTGSIPVPYIQRYEENQPYITDGHRPSS
GSGNLVAVPSEPSKKANIQRKLPALARVKQARVPNAYDKTALKLEIGDTITVTKMNINGQ
WEGELNGKYGHFPFTHLCLIYIL
Download sequence
Identical sequences E0VNA4
vb|PHUM332570-PA|EEB14860.1|Adapter XP_002427598.1.24195 121224.XP_002427598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]