SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM333110-PA|EEB14875.1|A from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM333110-PA|EEB14875.1|A
Domain Number 1 Region: 265-364
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.76e-21
Family Tudor domain 0.00073
Further Details:      
 
Domain Number 2 Region: 38-115
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 118-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM333110-PA|EEB14875.1|A
Sequence length 456
Comment kinase anchor protein, putative|DS235335.1:478524:483754:-1|gene:PHUM333110
Sequence
MSWKTTAAFLTLTFFGLGSLVYFLFKEEEEGQDFLSLNGANTSELEVTIPEESLGIIIGR
GGNTIKNIEVQSNVKIHIVENGSINGKYRKCIIRGTPEAAQYAESLIHELIVNQPLIETF
EMLVPSQACGRIIGKNGDSIRLISRNSNTKIIVENLSTAPFSLEKKIIIKGTSDQIAIAK
LLVEQKVEEDMKFRNKIETQILNRPPRNKAKYLLPSKGECEEVDSYTQKQKFIATSSNGL
LEVYVSAIENPDRMWLQMMGPSTVELDRLIEQMTDYYKKKENKILHALHEVKCGQIVAAP
FTYDDRWYRAEVQEIQNDNNENYILLYYVDYGDSSRCKKNEIFELRTDFLRLRFQAIECM
LAKIKPSGSTWSDESIDLLEDLTHVALWKSLMAKIHTYKDRPTKCQREGSPVPCIELYDI
QGENTINVAEELVRKGFAIWENDKSSPVTTATTATV
Download sequence
Identical sequences E0VNB8
vb|PHUM333110-PA|EEB14875.1|A XP_002427613.1.24195 121224.XP_002427613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]