SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM333280-PA|EEB14881.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM333280-PA|EEB14881.1|conserved
Domain Number 1 Region: 458-570
Classification Level Classification E-value
Superfamily Sec7 domain 0.000000497
Family Sec7 domain 0.0045
Further Details:      
 
Weak hits

Sequence:  vb|PHUM333280-PA|EEB14881.1|conserved
Domain Number - Region: 845-983
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0108
Family 3-Methyladenine DNA glycosylase I (Tag) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM333280-PA|EEB14881.1|conserved
Sequence length 1848
Comment hypothetical protein|DS235335.1:513064:520952:1|gene:PHUM333280
Sequence
MIALAVAGFQKIIKDDRFHSYVEPEDDTKWLLQQLLCSTRCFFSLPYDTQVDILKVFLNV
ASSHKWSLNGRTIIAVIGLFSDAFDSKNVAIKTVAQAAACQYICTYCYSVKKKYEEDKNV
LYFNELLPIMQFICCKIKEIDCQNQCDKKTLFYLENLLTLCRNLPPAISLNNFIKIFFWQ
KLAPALISLFGTPEVDKSLNSKNINTDEQTVKNSTSFISNYAKIVFSIYIELIRLFASVA
SLRPVLESLLYRILKYSTPEYRLDALKGVGQLIQKPDRLLDISGPLYDDENNQPFSDLSL
LLLIMNSIEDSCKSNFNLIQACILCCYNFLKAVEEFSIGKCIPEKIAVKICEMYPKLEDL
DFSDLSNFKNLNKEYLENYLEVDDPFNFVKTFENTSKSVNFKFKIFDRRNSFDKIKKNKK
KDLQISLHGNKNSCVLQNIQLNVPHFSYDIKERKSASHFISALDVLLPQLVHIKSSTQID
QVLQSFASRYCEDIINEHGESTIHIISADGFYLVTYLTLIINLEMFHSYCYSFSELKNTI
SEDYFLKKAESIGVTAYFTNVWLRELFQLISISCFLQTHGFLSTNFNSQPHALINLLTDI
EGVDFCHNGSQMLWACRRLENSLTLNDDNFERKAGLRLSRGILMCCLDSVLKILAVPLNQ
SIRKKENFKNLRFLKKVSHYKENKELITYSIDGLQILVRLCNDLGMQDKSETIVELLTSV
ACSDHYDVKLRLMRFDITNDSVVYLTSSHALTLDLLLSFGLELGSHCSNSWPHIFRCCTY
VKKLEHKYFSQLKNRDSELRTKIIKKDDNWSVVVNDLNFDFKCEEETNVDVYKFLLSQGA
QQSITEILSENNNLNDFLNGSETTKVISILSQRVDKLFENAASKLNLKSLESFSLALCCL
SQAQLFFESSKSDNSFKQYWWHRFTTNKNIFDESDTINDSLLLDSVGEIMIKCIKSGRPI
FHVMRIWGIIGPHLMEASCHKDITISRKAVKLIHDVINISLTEHTELPHFYVNESLFKPF
ESLLGLELCEPDIQDQIVSCICEFVEANFSEIRSGWRPLFGALRAITLNSNILLYVFKVF
LETGNVLVFSYAAVDYVMCLLKHLRVQTCCNDNSEIAFEIIKYLKSYQEILSSLYLIPGN
TAVFQFAHYIQVSDGLLVDPYIPDIEDYGYILEKLMIGDENILFIRPDSPKCDTSLNAID
HSSGILKVWFLLLEGTYSAAISATSSIQSFLLNMFYADLLKLIENPGSIFGLIVLNRIVL
PMTQSWLRQTSKIEKSEISGLKQSIGLLTDLFLQYFNRLKNEKICEDLLNLLVNQVLLLL
SECSFHYISTIATFGPACIRHIVINVGENFNCHQWNCVIISLQRICKISLGILLKLIMAF
SENSEYENDCQVKIVVNDTDNPDVQNLIQLSQRVFSKNNNNNNNKKVDFVFLSDLNDDDD
DDDDDDDKKEQIFVIRNEEEDKMISFNLFVNSMQSHHSILEIIALILLEKIGPGKIKAEN
ILINSMFNTINKVNDQDKSKTHGSLSCLSCNDILTLLSCLDFSYYLSLAFDSSSELKFAI
KKVTKLEQDVTLHRQGVAAATIKLTFLLEHCIALIEKHGVKGDDLIKLINNNSKNDDDDD
TFSDHLIFYCKKLQKSISVLCKTCVEFALNKKSVNTCMLNKEFLFKTYASGCVMDESNKL
DRDNDRKRFPEENHVVSGSFPSNDFTEDENCIEINKNEKETQTELKTNDGGFDKYDEEKS
FENFQKENDFSSAPEIKNHDDGFDDGFITENEGHHHSHQMCMEILYDFLESLLCLNDLDF
QMIFPLVYNETENFYTIYFFQPSLQSVISKILQRINVMNDSNDVIENF
Download sequence
Identical sequences E0VNC5
vb|PHUM333280-PA|EEB14881.1|conserved 121224.XP_002427619 XP_002427619.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]