SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM335200-PA|EEB14935.1|Signal from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM335200-PA|EEB14935.1|Signal
Domain Number 1 Region: 367-622
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.29e-97
Family STAT DNA-binding domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 175-373
Classification Level Classification E-value
Superfamily STAT 1.22e-50
Family STAT 0.00012
Further Details:      
 
Domain Number 3 Region: 41-163
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.53e-34
Family Transcription factor STAT-4 N-domain 0.00079
Further Details:      
 
Domain Number 4 Region: 623-749
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-33
Family SH2 domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM335200-PA|EEB14935.1|Signal
Sequence length 791
Comment transducer and activator of transcription 5B, putative|DS235339.1:364642:369217:1|gene:PHUM335200
Sequence
MSLELMTSEMYLWIVVTLWPVVNQSFTGFENEQIKAPQEEMSLWTKSQQLTGDALQQVRS
LYGEHFPIEVRHFLAGWLEAKMWNEVDPDNPQHDQYVSGLVNALINELEMKANTLTSEDM
FLTKLKLIETASNFRTRYSQNPHSLLRLIRHCLDKEMKLVQQSESGVAGNMNMSAMPDVM
SELAQQLEFLRRRTHDTAEDLRKMEQDQEAFALHYHECTKINAHLQHLQTQGQNPQNIEL
EKKLKRQKDNMEQMLNQKVSAMVQLRMSLVDKLKETISHLTALQSRILDSELIRWKREQQ
LAGNGAHFNSNLDSIQEWCENLAEIIWLNRQQIKEAERLKQKLSLDPPGLVDVLPNLNNL
VTQLLSTLVTSTFIIEKQPPQVMKTNTRFTSTVRLLVGGKLNVHMTPPQVKVTIISEAQA
NVLLKNDKMVKNEASGEILNNTGTMEYHQATRQLSVSFRNMQLKKIKRAEKKGTESVMDE
KFSLFFQSQFSVGGGELVFQVWTLSLPVVVIVHGNQEPHAWATVTWDNAFAEPGRVPFAV
PDKVPWSQVAEALNVKFKAATGRSLTEDNLKFLGEKAFRSTQPGDYGPLLLSWSQFCKEP
LPERNFTFWEWFYAVMKLTREHLRGPWIDGAIIGFIRKKQAEEMLMACPQGTFLLRFSDS
ELGGVTIACVGTGPGGKDINFNFKQKEIYMLQPFTSKDFAIRSLADRISDLSQFVYLYPD
IRKDVAFSKYYTPFTENQPNLINGYVKPLLVTHVPGWGPSLGCNPGTPQTMFQPQSPDTR
DTPSVAGSVNR
Download sequence
Identical sequences E0VNH9
XP_002427673.1.24195 121224.XP_002427673 vb|PHUM335200-PA|EEB14935.1|Signal

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]