SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM338400-PA|EEB14994.1|prefoldin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM338400-PA|EEB14994.1|prefoldin
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily Prefoldin 2.09e-21
Family Prefoldin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM338400-PA|EEB14994.1|prefoldin
Sequence length 174
Comment subunit, putative|DS235341.1:91142:91760:1|gene:PHUM338400
Sequence
MTSNNEPAKKGKSSKPKTSEEILMGFQKLRSEQRFLTTKLSEMELELQEHRIVIDALKDI
EGDRKCYRMIGGILCERTVKDVLPILKTNEENLVKVVESFHRQLVAKGSEINKYKEDNNV
KLKHIDELNDISENANAQTPVPDNSGKNDTGSADGNVGGDGGGGGGNNSSVLVS
Download sequence
Identical sequences E0VNN8
vb|PHUM338400-PA|EEB14994.1|prefoldin XP_002427732.1.24195 121224.XP_002427732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]